Product Name: Anti-C1ORF25 antibody produced in rabbit

Product Type: Chemical

CAS NO: 1058156-90-3Histone_Modification_Research_Compound_Library inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 61 kDa
NCBI accession no.
NP_112196
Shipped in: wet ice
species reactivity
human, mouse, rat, canine, horse, bovine, pig
Storage temp.: −20°C
Application: Rabbit Anti-C1ORF25 antibody can be used for western blot (1μg/ml) applications.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
General description: C1ORF25 is known to modulate motor coordination, exploratory behaviour and neuronal activities. Rabbit Anti-C1ORF25 antibody recognizes human, mouse, rat, and bovine C1ORF25.
Immunogen:
The immunogen for anti-C1ORF25 antibody: synthetic peptide derected towards the N terminal of human C1ORF25
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: QAPALSPSLASAPEEAKSKRHISIQRQLADLENLAFVTDGNFDSASSLNS
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/2/657

Related Post