Product Name: Anti-POU3F2 (AB1) antibody produced in rabbit

Synonym: Anti-POU domain, class 3, transcription factor 2

Product Type: Chemical

CAS NO: 1174161-86-4nAChR inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 47 kDa
NCBI accession no.
NP_005595
Shipped in: wet ice
species reactivity
rat, pig, human, bovine
Storage temp.: −20°C
Application: Anti- POU3F2 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 μg/ml.
Biochem/physiol Actions:
POU domain factors are characterized by the DNA-binding POU domain that is highly conserved. These factors bind to DNA and regulate transcription by protein-protein interactions. POU domain factors are critical regulators of early embryogenesis, development of mammalian forebrain, development and function of neuroendocrine system, regulation of gene expression in pituitary gland and hypothalamus.
Immunogen:
The immunogen for anti-POU3F2 antibody: synthetic peptide derected towards the C terminal of human POU3F2
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: QLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGVQTP
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/3/1007

Related Post