Product Name: Anti-RAB3D antibody produced in rabbit

Synonym: Anti-D2-2; Anti-GOV; Anti-RAB16; Anti-RAB3D, member RAS oncogene family; Anti-RAD3D

Product Type: Chemical

CAS NO: 1173111-67-5c-Met_HGFR inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 24 kDa
NCBI accession no.
NP_004274
Shipped in: wet ice
species reactivity
rat, mouse, bovine, rabbit, human
Storage temp.: −20°C
Application: Rabbit polyclonal anti-RAB3D antibody is used to tag RAB3D, member RAS oncogene family for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of RAB3D, member RAS oncogene family in exocytosis and transcytosis within non-neuronal secretory cells. Anti- RAB3D antibody produced in rabbit is suitable for western blotting at a concentration of 2.5 μg/ml.
General description: RAB3D, member RAS oncogene family (RAB3D, RAB16, RAD3D, GOV, D2-2) is a low molecular weight Ras-like GTPase involve in the regulation of intravesicle transport during exocytosis and apically directed transcytosis. RAB3D is found primarily in the secretory granules of non-neuronal exocrine secretory cells such as mast cells and pancreatic acinar cells.
General description: Rabbit polyclonal anti-RAB3D antibody reacts with bovine, human, mouse, and rat RAB3D, member RAS oncogene family GTPases.
Immunogen:
The immunogen for anti-RAB3D antibody: synthetic peptide derected towards the C terminal of human RAB3D
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: KENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSS
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/1/342

Related Post