Anti-SFRP1 antibody produced in rabbit

Product Name: Anti-SFRP1 antibody produced in rabbit

Synonym: Anti-Secreted frizzled-related protein 1

Product Type: Chemical

CAS NO: 425399-05-9Dopamine Receptor inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 35 kDa
NCBI accession no.
NP_003003
Shipped in: wet ice
species reactivity
human, bovine, horse, guinea pig, mouse, rat, canine
Storage temp.: −20°C
Application: Anti-SFRP1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.3 μg/ml.
Biochem/physiol Actions:
Secreted Frizzled-related protein 1 (SFRP1) is a secreted antagonist of Wnt signaling pathway. It is secreted in excess amounts during DNA damage- or oxidative stress-induced cellular senescence. SFRP1 is a modulator of normal and malignant hematopoiesis and cell proliferation. Gene polymorphisms, aberrations and methylation of SFRP1 is a feature in bladder cancers resulting in excessive activation of Wnt pathway.
Immunogen:
The immunogen for anti-SFRP1 antibody: synthetic peptide derected towards the middle region of human SFRP1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: HQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPT
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/1/28