Product Name: Anti-TAF7 antibody produced in rabbit

Synonym: Anti-TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55 kDa

Product Type: Chemical

CAS NO: 1123838-51-6PAI-1 inhibitors
antibody Form: IgG fraction of antiserum
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 40 kDa
NCBI accession no.
NP_005633
Shipped in: wet ice
species reactivity
rat, zebrafish, guinea pig, human, bovine, mouse
Storage temp.: −20°C
Application: Anti-TAF7 antibody produced in rabbit is suitable for western blotting at a concentration of 5-8 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Biochem/physiol Actions:
TAF7 is a component of TFIID transcription factor complex and binds to TAF1 component to regulate transcription initiation of TAF1-dependent genes. In collaboration with TAF1, it regulates the phosphorylation of histone H3 acetylation at cyclin D1 and cyclin A promoters. TAF7 regulates the transcription activity of other transcription factors such as P-TEFb, TFIIH and CIITA in transcription initiation and is essential for differentiation of mature T cells.
Immunogen:
The immunogen for anti-TAF7 antibody: synthetic peptide derected towards the N terminal of human TAF7
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPD
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/1.cover-expansion

Related Post