Anti-TFAP2A antibody produced in rabbit

Product Name: Anti-TFAP2A antibody produced in rabbit

Synonym: Anti-Transcription factor AP-2 α (activating enhancer binding protein 2 α)

Product Type: Chemical

CAS NO: 1354825-62-9VDAC inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 48 kDa
NCBI accession no.
NP_001035890
Shipped in: wet ice
species reactivity
human, guinea pig, rat, canine, rabbit, mouse
Storage temp.: −20°C
Application: Anti-TFAP2A antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 μg/ml.
Biochem/physiol Actions:
TFAP2A is a transcription factor that has both activator and repressor activities. The genes regulated by TFAP2A are involved in cell-type-specific proliferation and differentiation during embryonic development. Anomalies of TFAP2A have been observed in branchiooculofacial syndrome. Abnormalities in TFAP2A protein contribute to abnormal maturation in placenta in high-risk pregnancies.
Immunogen:
The immunogen for anti-TFAP2A antibody: synthetic peptide derected towards the C terminal of human TFAP2A
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: NLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSS
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/3/699