Anti-HOXC6 antibody produced in rabbit

Product Name: Anti-HOXC6 antibody produced in rabbit

Synonym: Anti-CP25; Anti-HHO.C8; Anti-HOX3; Anti-HOX3C; Anti-Homeobox C6

Product Type: Chemical

CAS NO: 1418741-86-2GSNOR inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 27 kDa
NCBI accession no.
NP_004494
Shipped in: wet ice
species reactivity
rat, rabbit, human, bovine, mouse, canine
Storage temp.: −20°C
Application: Anti-HOXC6 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
Biochem/physiol Actions:
HOXC6 belongs to the homeoprotein family of transcription factors that regulate morphogenesis and differentiation during embryonic development. Extensive crosstalk between HOXC6 and Wnt, Notch and PI3Kpathways has been observed in prostate cancer progression. HOXC6 also modulates the expression of Bcl-2 and regulates anti-apoptotic pathway in human head and neck squamous cell carcinoma.
Immunogen:
The immunogen for anti-HOXC6 antibody: synthetic peptide derected towards the C terminal of human HOXC6
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: KIWFQNRRMKWKKESNLTSTLSGGGGGATADSLGGKEEKREETEEEKQKE
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/3/873