CRG-2 from mouse

Product Name: CRG-2 from mouse

Synonym: CXCL10; Cytokine Responsive Gene 2; IP-10

MDL Number: MFCD01866130
Product Type: Chemical

CAS NO: 1006378-90-0Endocrinology inhibitors
Assay: ≥97% (SDS-PAGE)
Form: lyophilized powder
impurities
endotoxin, tested
Mol wt: predicted mol wt ~8.8 kDa
product line
BioReagent
Recombinant: expressed in E. coli
Storage temp.: −20°C
suitability
suitable for cell culture
Analysis Note:
The biological activity is measured by its ability to chemoattract human lymphocytes cultured in the presence of IL-2 for 21 days, or mouse BaF/3 cells transfected with hCXCR-3.
General description: Recombinant Mouse CRG-2 is produced from a DNA sequence encoding the mature mouse CRG-2/IP-10 protein sequence (MIPLARTVRCNCHIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTI KNLMKAFSQKRSKRAP). The methionyl Form of the E. coli-expressed mature CRG-2 contains 78 amino acid residues and has a predicted molecular mass of approximately 8.8 kDa.

Recombinant Mouse CRG-2 (IP-10, CXCL10) is a member of the chemokine ??subfamily that lacks the ELR domain. Mouse CRG-2 cDNA encodes a 98 amino acid residue precursor protein with a 21 amino acid residue signal peptide that is cleaved to Form the 77 amino acid residue secreted mature protein. Mature mouse CRG-2 shares approximately 67% amino acid sequence identity with human IP-10.
Physical Form: Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4, containing 50μg bovine serum albumin per 1μg of cytokine
RIDADR: NONH for all modes of transport
WGK Germany: 3
Purity: ≥97% (SDS-PAGE)
Storage Temp.: −20°C
UNSPSC
12352200
PubMed ID:http://jpet.aspetjournals.org/content/93/3/401