PrEST Antigen RRP36

Product Name: PrEST Antigen RRP36

Synonym: C6orf153; dJ20C7.4

Product Type: Chemical

CAS NO: 1146-98-1GHSR inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000124541
Form: buffered aqueous solution
Immunogen sequence: QPLQRMEQQEMAQQERKQQQELRLALKQERRAQAQQGHRPYFLKKSEQRQLALAEKFKELKRSKKL
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q96EU6
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human RRP36withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA029905.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/304/3/1161