Product Name: PrEST Antigen SEPT1 Synonym: DIFF6; PNUTL3 Product Type: Chemical CAS NO: 516-54-1HIV inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000180096Form: buffered aqueous solutionImmunogen sequence: EVTHDLLYEGYRARCLQSLARPGARDRASRSKLSRQSATEIPLPMLPLADTEKMol wt: predicted mol wt 24 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°C …
Monthly Archives: July 2017
PrEST Antigen DDX28
Product Name: PrEST Antigen DDX28 Synonym: FLJ11282; MDDX28 Product Type: Chemical CAS NO: 1617495-03-0HBV inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000182810form: buffered aqueous solutionImmunogen sequence: TLLDESFLELVDYILEKSHIAEGPADLEDPFNPKAQLVLVGATFPEGVGQLLNKVASPDAVTTITSSKLHCIMPHVKQTFLRLKGADKMol wt: predicted mol wt 27 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt …
PrEST Antigen CMTR2
Product Name: PrEST Antigen CMTR2 Synonym: AFT; FLJ11171; MTr2 Product Type: Chemical CAS NO: 19309-14-9Filovirus inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000180917Form: buffered aqueous solutionImmunogen sequence: DKVAKGYFNSWAEEHGVYHPGQSSILEGTASNLECHLWHILEGKKLPKVKCSPFCNGEILKTLNEAIEKSLGGAFNLDSKFRPKQQYSCSCHMol wt: redicted mol wt 28 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in:wet ice Storage condition:avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt …
PrEST Antigen IST1
Product Name: PrEST Antigen IST1 Synonym: KIAA0174 Product Type: Chemical CAS NO: 146062-49-9Bacterial inhibitors Assay: >80% (SDS-PAGE) Concentration: ≥0.5 mg/mL Conjugate: His tagged Ensembl | human accession no.: ENSG00000182149 Form: buffered aqueous solution Immunogen sequence: LGSGFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLL Mol wt: predicted mol wt 27 kDa Purified by: immobilized metal affinity chromatography (IMAC) recombinant: expressed in E. coli Shipped in: …
PrEST Antigen ANKS4B
Product Name: PrEST Antigen ANKS4B Synonym: FLJ38819; HARP Product Type: Chemical CAS NO: 864677-55-4Anti-infection inhibitors Assay: >80% (SDS-PAGE) Concentration: ≥0.5 mg/mL Conjugate: His tagged Ensembl | Cuman accession no.: ENSG00000175311 Form: buffered aqueous solution Immunogen sequence: VALLDKAATAQNIMNPKKVTRLKEQAQKNARRQIKECERLQEKHQNKMAHTYSKEESGTLSSSKGTFSRSSPSNASAP Mol wt: predicted mol wt 26 kDa Purified by: immobilized metal affinity chromatography (IMAC) Recombinant: expressed in E. coli Shipped …
Mutations from each of the viable complementation groups were tested with mei-P221
d to be overexpressed in a variety of human cancer cell lines and ectopic overexpression of Aurora-C can also induce cell transformation and tumor formation. However, its expression in tumor cells and normal somatic tissues is still the matter of some debate. AuroraB is a member of the chromosomal passenger complex, which localizes to the …
The functional differences in these proteins during male meiotic divisions remain largely unknown
er, the order of these subsequent compositional changes remains unclear. A number of studies including very recent single molecule studies in yeast, indicate that the recruitment of the NTC occurs after release of the U4 snRNA, which is consistent with U4/U6 protein release preceeding recruitment of the vast majority of the Prp19/CDC5L complex. Release of …
In grey lowercase. (D) As one estimate of the significance level
In grey lowercase. (D) As one estimate of the significance level for apparent shifts between constructs, normalized expression values were compared by ANOVA, followed by Tukey’s Honest 10781694 Significant Differences pair-wise comparisons. Calculated p-values are indicated in the intersection between construct designations. Potential scaling differences between sequential experiments on different days (indicated by gaps between …
Continue reading “In grey lowercase. (D) As one estimate of the significance level”
Arabinose. V52 and the isogenic vasK mutant were used as positive
Arabinose. V52 and the isogenic vasK mutant were used as positive and negative controls, respectively. Pellets and culture supernatants were separated by centrifugation. The supernatant portions were concentrated by TCA precipitation and both fractions were subjected to SDS-PAGE followed by western blotting using the antibodies FCCP site indicated. (B) Survival of
N “OneSiteBind” model Y = Bmax 6 X/(Kd + X). Y represents the
N “OneSiteBind” model Y = Bmax 6 X/(Kd + X). Y represents the percentage of bound ligand in the total amount of ligand, and X represents the concentration of NK1R-NLPs in the solution after reaction. The fitting results in 3665.6 nM for Bmax and 83633 nM for Kd. doi:10.1371/journal.pone.0044911.gGPCR through de novo expression using the …
Continue reading “N “OneSiteBind” model Y = Bmax 6 X/(Kd + X). Y represents the”