Product Name: PrEST Antigen SCAMP4 Synonym: FLJ33847 Product Type: Chemical CAS NO: 942206-85-1Fungal inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000227500Form: buffered aqueous solutionImmunogen sequence: KVHRIYRGAGGSFQKAQTEWNTGTWRNPPSREAQYNNFSGNSLPEYPTVPSYPGSGQWPMol wt: predicted mol wt 24 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt accession …
Yearly Archives: 2017
PrEST Antigen ZGLP1
Product Name: PrEST Antigen ZGLP1 Synonym: GLP-1; GLP1 Product Type: Chemical CAS NO: 5534-95-2CMV inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000220201Form: buffered aqueous solutionImmunogen sequence: LLDRDSKDTQTRISQKGRRLQPPGTPSAPPQRRPRKQLNPCRGTERVDPGFEGVTLKFQIKPDSSLQIIPTYSLPCSSRSQEMol wt: predicted mol wt 27 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°C …
PrEST Antigen ZNF564
Product Name: PrEST Antigen ZNF564 Synonym: MGC26914 Product Type: Chemical CAS NO: 67920-52-9Arenavirus inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000249709Form: buffered aqueous solutionImmunogen sequence: FQRHERAHNGDKPYVKNVGKLSFITQPSNTCEMol wt: predicted mol wt 21 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt accession …
PrEST Antigen SMIM7
Product Name: PrEST Antigen SMIM7 Synonym: C19orf42; MGC2747 Product Type: Chemical CAS NO: 125314-13-8Others inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000214046Form: buffered aqueous solutionImmunogen sequence: KKDTQGFGEESREPSTGDNIREFLLSLRMol wt: predicted mol wt 21 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°C …
PrEST Antigen PRODH2
Product Name: PrEST Antigen PRODH2 Synonym: HSPOX1 Product Type: Chemical CAS NO: 1801747-11-4Alkaloid inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000250799Form: buffered aqueous solutionImmunogen sequence: GNLGAMLRCVDLSRGLLEPPSLAEASLMQLKVTALTSTRLCKELASWVRRPGASLELSPERLAEAMDSGQNLQVSCLNAEQMol wt: predicted mol wt 26 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt accession …
PrEST Antigen IGSF23
Product Name: PrEST Antigen IGSF23 Product Type: Chemical CAS NO: 1404437-62-2Terpenoids and Glycosides inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000216588Form: buffered aqueous solutionImmunogen sequence: YMCIATNSKKQLVSEPVTISLPKPIMQPTEAEPMEPDPTLSLSGGSAIGLMol wt: predicted mol wt 23 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt accession …
PrEST Antigen ADAT3
Product Name: PrEST Antigen ADAT3 Synonym: TAD3 Product Type: Chemical CAS NO: 33996-33-7Quinones inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000213638Form: buffered aqueous solutionImmunogen sequence: GAVRKLDADEDGLPYLCTGYDLYVTREPCAMCAMALVHARILRVFYGAPSPDGALGTRFRIHARPDLNHRFQVFRGVLEEQCRWLDMol wt: predicted mol wt 27 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°C Application: …
PrEST Antigen PRR22
Product Name: PrEST Antigen PRR22 Synonym: MGC24975 Product Type: Chemical CAS NO: 219832-49-2Saccharides and Glycosides inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000212123Form: buffered aqueous solutionImmunogen sequence: DIRSLCLPEELLSFDYSVPEILDTVSNVDYFFNFKALDEEQPPHPGPPATNTPAPILSGKRKASTAKKGKPGRKARQPAGPASATPPGPREDLGATMol wt: predicted mol wt 28 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: …
PrEST Antigen DENND1C
Product Name: PrEST Antigen DENND1C Synonym: FAM31C; FLJ22757 Product Type: Chemical CAS NO: 1346547-00-9Cell_Counting_Kit-8 inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000205744Form: buffered aqueous solutionImmunogen sequence: PSPPESPQILAPTKPNFDIAWTSQPLDPSSDPSSLEDPRARPPKALLAERAHLQPREEPGALNSPATPTSNCQKSQPSSRPRVADLKKCFEMol wt: predicted mol wt 27 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt …
PrEST Antigen QTRT1
Product Name: PrEST Antigen QTRT1 Synonym: TGT Product Type: Chemical CAS NO: 537034-15-4Phosphatase_Inhibitor_Cocktail_I inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000213339Form: buffered aqueous solutionImmunogen sequence: LRKKVFEKDFGPIDPECTCPTCQKHSRAFLHALLHSDNTAALHHLTVHNIAYQLQLMSAVRTSIVEKRFPDFVRDFMGAMYGDPTLCPTWAMol wt: predicted mol wt 28 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt accession …