Product Name: PrEST Antigen B9D2 Synonym: MGC4093 Product Type: Chemical CAS NO: 1448169-71-8Reverse Transcriptase inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000123810Form: buffered aqueous solutionImmunogen sequence: MAEVHVIGQIIGASGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHFQVWMol wt: predicted mol wt 27 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt …
Yearly Archives: 2017
PrEST Antigen LYPD3
Product Name: PrEST Antigen LYPD3 Synonym: C4.4A Product Type: Chemical CAS NO: 848258-31-1Influenza Virus inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000124466Form: buffered aqueous solutionImmunogen sequence: DGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNMol wt: predicted mol wt 27 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt …
PrEST Antigen IRGC
Product Name: PrEST Antigen IRGC Synonym: CINEMA; IRGC1; Iigp5 Product Type: Chemical CAS NO: 37988-18-4HIV inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000124449Form: buffered aqueous solutionImmunogen sequence: ALLIHSLRGYHRSFGLDDDSLAKLAEQVGKQAGDLRSVIRSPLANEVSPETVLRLYSQSSDGAMRVARAFERGIPVFGTLVAMol wt: predicted mol wt 26 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: …
PrEST Antigen OPA3
Product Name: PrEST Antigen OPA3 Synonym: FLJ22187; MGA3 Product Type: Chemical CAS NO: 85375-15-1HBV inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000125741Form: buffered aqueous solutionImmunogen sequence: RHQLQQRRKEKERRVAREALRGEVGHLGLALEELQAQVQATSTQLALEELRAQLQEVRAHLCLRDPMol wt: predicted mol wt 25 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt …
PrEST Antigen SNRPD2
Product Name: PrEST Antigen SNRPD2 Synonym: SNRPD1; Sm-D2 Product Type: Chemical CAS NO: 488-81-3Filovirus inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000125743Form: buffered aqueous solutionImmunogen sequence: REEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEMol wt: predicted mol wt 24 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt …
PrEST Antigen SYMPK
Product Name: PrEST Antigen SYMPK Synonym: SPK; SYM Product Type: Chemical CAS NO: 223499-30-7Bacterial inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000125755Form: buffered aqueous solutionImmunogen sequence: PNPPSVLFGADKDTEVAAPWTEETVKQCLYLYLALLPQNHKLIHELAAVYTEAIADIKRTVLRVIEQPIRGMGMNSPELLLLVENCPKGAMol wt: predicted mol wt 28 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt …
PrEST Antigen SCAF1
Product Name: PrEST Antigen SCAF1 Synonym: FLJ00034; SR-A1 Product Type: Chemical CAS NO: 22260-51-1Anti-infection inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000126461Form: buffered aqueous solutionImmunogen sequence: SRKVKLQSKVAVLIREGVSSTTPAKDAASAGLGSIGVKFSRDRESRSPFLKPDERAPTEMAKAAPGSTKPKKTKVKAKAGAKKTKGTKGKTKPSKTMol wt: predicted mol wt 28 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt …
PrEST Antigen TSKS
Product Name: PrEST Antigen TSKS Synonym: TSSKS Product Type: Chemical CAS NO: 16561-29-8Acids and Aldehydes inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000126467Form: buffered aqueous solutionImmunogen sequence: LTPACPSCQRLHKKILELERQALAKHVRAEALSSTLRLAQDEALRAKNLLLTDKMKPEEKMATLDHLHLKMCSLHDHLSNLPLEGSTGTMGGGSSAGTMol wt: predicted mol wt 28 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: …
PrEST Antigen PPP1R12C
Product Name: PrEST Antigen PPP1R12C Synonym: DKFZP434D0412; LENG3; MBS85; p84; p85 Product Type: Chemical CAS NO: 760961-03-3Alkaloid inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000125503Form: buffered aqueous solutionImmunogen sequence: DIARYLLSHGANIAAVNSDGDLPLDLAESDAMEGLLKAEIARRGVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHVMol wt: predicted mol wt 27 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw …
PrEST Antigen MIER2
Product Name: PrEST Antigen MIER2 Synonym: KIAA1193 Product Type: Chemical CAS NO: 1343403-10-0Terpenoids and Glycosides inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000105556Form: buffered aqueous solutionImmunogen sequence: SPRVVSCLEHSLCPGEPGLQTTAVVSMGSGDHQFNLAEILSQNYSVRGECEEASRCPDKPKEELEKDFISQSNDMPFDELLALYGYEASDPISDREMol wt: predicted mol wt 28 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: …