Anti-CCNH antibody produced in rabbit

Product Name: Anti-CCNH antibody produced in rabbit

Synonym: Anti-Cyclin H

Product Type: Chemical

CAS NO: 179068-02-1Haspin Kinase inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 38 kDa
NCBI accession no.
NP_001230
Shipped in: wet ice
species reactivity
rabbit, human, horse, rat, guinea pig, mouse
Storage temp.: −20°C
Application: Anti- CCNH antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Biochem/physiol Actions:
Cyclin H associates with cyclin-dependent kinase7 (Cdk7) and the complex regulates RNA polymerase in several species. It regulates the transcription machinery required for larval development of zebrafish. In Arabidopsis, CCNH is essential in drought stress responses independent of cyclin dependent kinase D. The expression of CCNH is increased in humans with gastrointestinal stromal tumors.
General description: Cyclins are key regulatory proteins that control cell cycle progression by phosphorylating cyclin-dependent kinases.
Immunogen:
The immunogen for anti-CCNH antibody: synthetic peptide derected towards the C terminal of human CCNH
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: KQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/327/3/884