Anti-CDKN2B antibody produced in rabbit

Product Name: Anti-CDKN2B antibody produced in rabbit

Synonym: Anti-Cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4)

Product Type: Chemical

CAS NO: 487-39-8Microtubule_Tubulin inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 15 kDa
NCBI accession no.
NP_004927
Shipped in: wet ice
species reactivity
mouse, pig, rabbit, rat, guinea pig, canine
Storage temp.: −20°C
Application: Anti-CDKN2B antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions:
CDKN2B has inhibitory effects on cell cycle progression. It binds to cyclin-dependent kinases and prevents their association with D-type cyclins. Methylation of CDKN2B has been associated with pathogenesis of pediatric myelodysplastic syndromes and in malignant hematopoiesis. Mutations in CDKN2B gene have been observed in malignant gliomas.
Immunogen:
The immunogen for anti-CDKN2B antibody: synthetic peptide derected towards the middle region of human CDKN2B
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: REGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/327/3/934