Anti-RGS10 antibody produced in rabbit

Product Name: Anti-RGS10 antibody produced in rabbit

Synonym: Anti-Regulator of G-protein signalling 10

Product Type: Chemical

CAS NO: 1801747-11-4PKC inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 21 kDa
NCBI accession no.
NP_002916
Shipped in: wet ice
species reactivity
rabbit, pig, horse, human, canine, guinea pig, bovine
Storage temp.: −20°C
Application: Anti-RGS10 antibody produced in rabbit is suitable for western blotting at a concentration of 0.2 μg/ml.
Biochem/physiol Actions:
Regulator of G-protein signaling-10 (RGS10) accelerates the GTPase activity of Gαi/q/z subunits. It renders neuroprotection to chronic systemic inflammation-induced degeneration of nigral dopaminergic (DA) neurons through PKA/cAMP response element pathway. RGS10 modulates chemokine secretion and regulates T cell adhesion by α4β1 and αLβ2 integrin-mediated signaling.
Immunogen:
The immunogen for anti-RGS10 antibody: synthetic peptide derected towards the middle region of human RGS10
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/1/2.1