Anti-RGS9 antibody produced in rabbit

Product Name: Anti-RGS9 antibody produced in rabbit

Synonym: Anti-Regulator of G-protein signalling 9

Product Type: Chemical

CAS NO: 1123837-84-2Cannabinoid Receptor inhibitors
antibody Form: IgG fraction of antiserum
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 49 kDa
NCBI accession no.
NP_003826
Shipped in: wet ice
species reactivity
horse, canine, human, rabbit, bovine, mouse, rat
Storage temp.: −20°C
Application: Anti-RGS9 antibody produced in rabbit is suitable for western blotting at a concentration of 2 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Biochem/physiol Actions:
RGS9 belongs to R7 group of RGS proteins that regulate neuronal responses and transmission of signals from extracellular environment. R7 RGS proteins regulates G protein signaling pathway components, motor control, nociception, vision and reward behavior in mammals.
Immunogen:
The immunogen for anti-RGS9 antibody: synthetic peptide derected towards the N terminal of human RGS9
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MYYQQALMRSTVKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQ
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/1/231