Anti-JUN (AB3) antibody produced in rabbit

Product Name: Anti-JUN (AB3) antibody produced in rabbit

Synonym: Anti-AP1; Anti-Jun oncogene; Anti-c-Jun

Product Type: Chemical

CAS NO: 1796565-52-0Factor Xa inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 36 kDa
NCBI accession no.
NP_002219
Shipped in: wet ice
species reactivity
bovine, mouse, rat, sheep, human, pig, rabbit, canine
Storage temp.: −20°C
Application: Anti-JUN (AB3) antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions:
c-Jun N-terminal kinase belongs to the family of MAP kinases that are activated by mitogens, environmental stress and inflammatory cytokines. The signaling mediated by c-Jun or the JNK pathway is involved in apoptosis, inflammation, proliferation, development and regulation of transcription factors in the mammalian cells.
Immunogen:
The immunogen for anti-JUN antibody: synthetic peptide derected towards the N terminal of human JUN
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/328/3/829