Anti-GTF2A1 antibody produced in rabbit

Product Name: Anti-GTF2A1 antibody produced in rabbit

Synonym: Anti-General transcription factor IIA, 1, 19/37 kDa

Product Type: Chemical

CAS NO: 1384426-12-3Pyruvate Dehydrogenase inhibitors
antibody Form: affinity isolated antibody
application(s)
immunohistochemistry: suitable

western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 42 kDa
NCBI accession no.
NP_056943
Shipped in: wet ice
species reactivity
bovine, human, rat, zebrafish, mouse
Storage temp.: −20°C
Application: Anti-GTF2A1 antibody produced in rabbit is suitable for western blotting at a concentration of 1-5 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Biochem/physiol Actions:
GTF2A1 is a transcription factor that binds to RNA polymerase II and is required for the transcription initiation of TATA-containing class II genes.
Features and Benefits:
Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perForm in your application, we will issue a full credit or replacement antibody. Learn more.
Immunogen:
The immunogen for anti-GTF2A1 antibody: synthetic peptide derected towards the C terminal of human GTF2A1
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: PQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDG
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/1/112