Anti-GRIA2 (AB1) antibody produced in rabbit

Product Name: Anti-GRIA2 (AB1) antibody produced in rabbit

Synonym: Anti-Glutamate receptor, ionotropic, AMPA 2

Product Type: Chemical

CAS NO: 148554-65-8GSK-3 inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 99 kDa
NCBI accession no.
NP_001077088
Shipped in: wet ice
species reactivity
human, guinea pig, rabbit, bovine, mouse, rat, horse, zebrafish
Storage temp.: −20°C
Application: Anti-GRIA2 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 2.5 μg/ml.
Biochem/physiol Actions:
GRIA2 or glutamate receptor 2 (GluR2) inhibits the influx of calcium through AMPA-receptor complexes. Mutations in GRIA2 gene have been associated with major psychiatric disorders such as schizophrenia and bipolar disorder.
Immunogen:
The immunogen for anti-GRIA2 antibody: synthetic peptide derected towards the N terminal of human GRIA2
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: STSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTIT
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/1/26