Anti-RAB14 antibody produced in rabbit

Product Name: Anti-RAB14 antibody produced in rabbit

Synonym: Anti-RAB14, member RAS oncogene family

Product Type: Chemical

CAS NO: ROS inhibitors
antibody Form: affinity isolated antibody
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 24 kDa
NCBI accession no.
NP_057406
Shipped in: wet ice
species reactivity
human, zebrafish, mouse, goat, pig, bovine, canine, rat
Storage temp.: −20°C
Application: Anti-RAB14 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 μg/ml.
Biochem/physiol Actions:
RAB14 is a member of Rab GTPases that regulate the roles and identity of endosomes. Rab14 collaborates with FAM116 in regulating proteolytic cleavage of N-cadherin, and modulation of cell-cell adhesion and cell motility. Rab14 mediates the endocytic transport of GLUT4 from cytoplasmic compartments to cell surface.
Immunogen:
The immunogen for anti-RAB14 antibody: synthetic peptide derected towards the C terminal of human RAB14
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCG
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/1/57