Anti-MMP2 antibody produced in rabbit

Product Name: Anti-MMP2 antibody produced in rabbit

MDL Number: MFCD02178885
Product Type: Chemical

CAS NO: 960539-70-2Hedgehog inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1  mg/mL
Conjugate: unconjugated
Form: lyophilized powder
Mol wt: mol wt 74 kDa
NCBI accession no.
NP_001121363
species reactivity
human, canine, mouse, horse, rabbit, bovine, rat, guinea pig, sheep
Storage temp.: −20°C
Application: Rabbit polyclonal anti-MMP2 antibody is used to tag matrix metalloproteinase-2 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of matrix metalloproteinase-2 in physiological and pathological processes that involve the degradation of extracellular matrices and basement membranes. Anti-MMP2 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
General description: Matrix metalloproteinase-2 (MMP-2), a member of the matrix metalloproteinase (MMP) family, is involved in the breakdown of extracellular matrix giving it a role in normal physiological processes such as embryonic development, tissue remodeling, wound repair, vascularization and inflammatory response. MMP-2 is involved in pathological processes such as arthritis and tumor metastasis. Matrix metalloproteinase-2 degrades type IV collagen, a major component of basement membranes.
General description: Rabbit polyclonal anti-MMP2 antibody reacts with human, mouse, rat, canine, pig, rabbit, and bovine Matrix metalloproteinase-2 enzymes.
Immunogen:
The immunogen for anti-MMP2 antibody: synthetic peptide derected towards the C terminal of human MMP2
Physical Form: Lyophilized from PBS buffer with 2% sucrose
Sequence:
Synthetic peptide located within the following region: AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/2.cover-expansion