Anti-KLF11 antibody produced in rabbit

Product Name: Anti-KLF11 antibody produced in rabbit

Synonym: Anti-Kruppel-like factor 11

Product Type: Chemical

CAS NO: 912288-64-3Estrogen Receptor_ERR inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 55 kDa
NCBI accession no.
NP_003588
Shipped in: wet ice
species reactivity
human, guinea pig, horse, rabbit, rat, bovine, canine, pig
Storage temp.: −20°C
Application: Anti-KLF11 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 μg/ml.
Biochem/physiol Actions:
KLF11 belongs to KLF family of transcription factors that regulate GC promoters and important metabolic processes in diverse organisms. The histone acetyltransferase pathways mediated by KLF11 affect the regulation of insulin in neonatal diabetes. KLF11 mediates increase in basal insulin levels and glucose-stimulated insulin secretion. It suppresses inflammatory activation of endothelial cells by inhibition of NF-κB pathway that results in downregulation of VCAM-1 and E-selectin promoters.
Immunogen:
The immunogen for anti-KLF11 antibody: synthetic peptide derected towards the N terminal of human KLF11
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: SQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCITPPQ
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/329/2/496