Anti-CDK4 (AB1) antibody produced in rabbit

Product Name: Anti-CDK4 (AB1) antibody produced in rabbit

Synonym: Anti-Cyclin-dependent kinase 4

MDL Number: MFCD00282839
Product Type: Chemical

CAS NO: 864863-72-9Influenza Virus inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 34 kDa
NCBI accession no.
NP_000066
Shipped in: wet ice
species reactivity
sheep, canine, bovine, pig, rat, human, rabbit
Storage temp.: −20°C
Application: Rabbit Anti-CDK4 (AB1) antibody can be used for western blot assays at 1μg/ml.
General description: CDK4 is a Ser/Thr kinase that regulates G1 phase progression in cells. Alterations in CDK4 have been linked to several cancers. Rabbit Anti-CDK4 (AB1) antibody binds to dog, bovine, pig, rat, and human CDK4.
Immunogen:
The immunogen for anti-CDK4 antibody: synthetic peptide derected towards the C terminal of human CDK4
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: PRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/327/3/1001