Anti-CDK2 (AB1) antibody produced in rabbit

Product Name: Anti-CDK2 (AB1) antibody produced in rabbit

MDL Number: MFCD00675227
Product Type: Chemical

CAS NO: 935273-79-3Apoptosis inhibitors
antibody Form: IgG fraction of antiserum
application(s)
western blot: suitable
biological source
rabbit
clone
polyclonal
Concentration: 0.5 mg – 1 mg/mL
Conjugate: unconjugated
Form: buffered aqueous solution
Mol wt: mol wt 34 kDa
NCBI accession no.
NP_001789
Shipped in: wet ice
species reactivity
zebrafish, human, guinea pig, bovine, rabbit, goat, mouse, sheep, rat
Storage temp.: −20°C
Application: Rabbit Anti-CDK2 (AB1) antibody can be used for western blot (1μg/ml) assays.
General description: Studies in human embryonic stem cells (hESCs) have reported that cyclin-dependent kinase 2 (CDK2) regulates G1 to S transition and DNA damage response in cells. Rabbit Anti-CDK2 (AB1) antibody binds to zebrafish, human, mouse, rat, chicken, bovine, rabbit, and canine CDK2.
Immunogen:
The immunogen for anti-CDK2 antibody: synthetic peptide derected towards the middle region of human CDK2
Physical Form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: VLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPE
RIDADR: NONH for all modes of transport
WGK Germany: 3
Storage Temp.: −20°C
UNSPSC
12352203
PubMed ID:http://jpet.aspetjournals.org/content/327/3/645