Product Name: PrEST Antigen MLYCD Synonym: MCD; hMCD Product Type: Chemical CAS NO: 1089283-49-7Terpenoids and Glycosides inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000103150Form: buffered aqueous solutionImmunogen sequence: KEHGRNELFTDSECKEISEITGGPINETLKLLLSSSEWVQSEKLVRALQTPLMRLCAWYLYGEKHRGYALNPVANFHLQNGAVLWRINWMADVSLRGITGSCGLMANYRYFLEETGPNSTSYLGSKIIKASEQVLSLVAQFQKNSKLMol wt: predicted mol wt 34 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage …
Author Archives: C14- demethylase
PrEST Antigen PCSK1
Product Name: PrEST Antigen PCSK1 Synonym: NEC1; PC1; PC3; SPC3 Product Type: Chemical CAS NO: 379231-04-6Quinones inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000175426Form: buffered aqueous solutionImmunogen sequence: RQFVNEWAAEIPGGPEAASAIAEELGYDLLGQIGSLENHYLFKHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERSKRSALRDSALNLFNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNMol wt: predicted mol wt 34 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage …
PrEST Antigen ADRB2
Product Name: PrEST Antigen ADRB2 Synonym: ADRB2R; ADRBR; B2AR; BAR Product Type: Chemical CAS NO: 475108-18-0Saccharides and Glycosides inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000169252Form: buffered aqueous solutionImmunogen sequence: CRSPDFRIAFQELLCLRRSSLKAYGNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTNDSLLMol wt: predicted mol wt 27 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated …
PrEST Antigen LRPAP1
Product Name: PrEST Antigen LRPAP1 Synonym: A2MRAP; HBP44 Product Type: Chemical CAS NO: 417716-92-8Cell_Counting_Kit-8 inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000163956Form: buffered aqueous solutionImmunogen sequence: RMEKLNQLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILAKYGLDGKKDARQVTSNSLSGTQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEKMol wt: predicted mol wt 33 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt …
PrEST Antigen ANKMY1
Product Name: PrEST Antigen ANKMY1 Synonym: FLJ20499; ZMYND13 Product Type: Chemical CAS NO: 162359-56-0Phosphatase_Inhibitor_Cocktail_II inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000144504Form: buffered aqueous solutionImmunogen sequence: SSFMDTNLESLYYEVNVPSQGSYELRPPPAPLLLPRVSGSHEGGHFQDTGQCGGSIDHRSSSLKGDSPLVKGSLGHVESGLEDVLGNTDRGSLCSAETKFESNVCVCDFSIELSQAMLERSAQSHSLLKMAMol wt: predicted mol wt 32 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt …
PrEST Antigen CAPN10
Product Name: PrEST Antigen CAPN10 Product Type: Chemical CAS NO: 796967-16-3Phosphatase_Inhibitor_Cocktail_I inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000142330Form: buffered aqueous solutionImmunogen sequence: FWLPLLEKVYAKVHGSYEHLWAGQVADALVDLTGGLAERWNLKGVAGSGGQQDRPGRWEHRTCRQLLHLKDQCLISCCVLSPRAGARELGEFHAFIVSDLMol wt: predicted mol wt 29 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt accession no.: Q9HC96 …
PrEST Antigen ACSS2
Product Name: PrEST Antigen ACSS2 Synonym: ACAS2; ACS; ACSA; AceCS; dJ1161H23.1 Product Type: Chemical CAS NO: 288383-20-0Inhibitor_Kit inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000131069Form: buffered aqueous solutionImmunogen sequence: PGETTQITYHQLLVQVCQFSNVLRKQGIQKGDRVAIYMPMIPELVVAMLACARIGALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQMol wt: predicted mol wt 34 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw …
PrEST Antigen PCSK2
Product Name: PrEST Antigen PCSK2 Synonym: NEC2; PC2; SPC2 Product Type: Chemical CAS NO: 319460-85-0Toxins_for_Antibody-drug_conjugates_research_Library inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000125851Form: buffered aqueous solutionImmunogen sequence: FTNHFLVELHKGGEDKARQVAAEHGFGVRKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDINMNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPMol wt: predicted mol wt 34 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: …
PrEST Antigen LRP1
Product Name: PrEST Antigen LRP1 Synonym: A2MR; APR; CD91; LRP Product Type: Chemical CAS NO: 183319-69-9Stem_Cell_Signaling_Compound_Library inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000123384Form: buffered aqueous solutionImmunogen sequence: STCTVNQGNQPQCRCLPGFLGDRCQYRQCSGYCENFGTCQMAADGSRQCRCTAYFEGSRCEVNKCSRCLEGACVVNKQSGDVTCNCTDGRVAPSCLTCVGHCSNGGSCTMNSKMMPECQCPPHMTGPRCEEHVFMol wt: predicted mol wt 32 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage …
PrEST Antigen SCAP
Product Name: PrEST Antigen SCAP Synonym: KIAA0199 Product Type: Chemical CAS NO: 184475-35-2Protein_Tyrosine_Kinase_Compound_Library inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000114650Form: buffered aqueous solutionImmunogen sequence: EVWDAIEGVLCCSSEEVSSGITALVFLDKRIVAARLNGSLDFFSLETHTALSPLQFRGTPGRGSSPASPVYSSSDTVACHLTHTVPCAHQKPITALKAAAGRLVTGSQDHTLRVFRLEDMol wt: predicted mol wt 30 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt accession …