Product Name: PrEST Antigen MTMR12 Synonym: 3-PAP; 3PAP; FLJ20476; KIAA1682; PIP3AP Product Type: Chemical CAS NO: 478296-72-9Terpenoids and Glycosides inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000150712Form: buffered aqueous solutionImmunogen sequence: RPEEIHTNEKEVTEKEVTLHLLPGEQLLCEASTVLKYVQEDSCQHGVYGRLVCTDFKIAFLGDDESALDNDETQFKNKVIGENDITLHCVDQIYGVFDEMol wt: predicted mol wt 29 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid …
Author Archives: C14- demethylase
PrEST Antigen DGKZ
Product Name: PrEST Antigen DGKZ Synonym: DAGK5; DAGK6; DGK-ZETA; hDGKzeta Product Type: Chemical CAS NO: 111025-46-8Quinones inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000149091Form: buffered aqueous solutionImmunogen sequence: EHLNYVTEIAQDEIYILDPELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPPQGEELIEAAKRNDFCKLQEMol wt: predicted mol wt 26 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage …
PrEST Antigen LRRC4C
Product Name: PrEST Antigen LRRC4C Synonym: KIAA1580; NGL-1 Product Type: Chemical CAS NO: 1290543-63-3Saccharides and Glycosides inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000148948Form: buffered aqueous solutionImmunogen sequence: ATTTPFSYFSTVTVETMEPSQDEARTTDNNVGPTPVVDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPMol wt: predicted mol wt 25 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage …
PrEST Antigen GAS2
Product Name: PrEST Antigen GAS2 Product Type: Chemical CAS NO: 211555-08-7Cell_Counting_Kit-8 inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000148935Form: buffered aqueous solutionImmunogen sequence: FAGYLLKHDPCRMLQISRVDGKTSPIQSKSPTLKDMNPDNYLVVSASYKAKKEIMol wt: predicted mol wt 24 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt accession no.: O43903 …
PrEST Antigen ZNF214
Product Name: PrEST Antigen ZNF214 Product Type: Chemical CAS NO: 364042-47-7Phosphatase_Inhibitor_Cocktail_II inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000149050Form: buffered aqueous solutionImmunogen sequence: CGCNKCKGIYYWNSRCVFHKRNQPGENLCQCSIRKACFSQRSDLYRHPRNHIGKKLYGCDEVDGNFHQSSGVHFHMol wt: predicted mol wt 26 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt accession no.: Q9UL59 …
PrEST Antigen C18orf25
Product Name: PrEST Antigen C18orf25 Synonym: MGC12909 Product Type: Chemical CAS NO: 144875-48-9Protease_Inhibitor_Cocktail_mini-Tablet inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000152242Form: buffered aqueous solutionImmunogen sequence: ESQLASTESDKPTTGRVYESDSSNHCMLSPSSSGHLADSDTLSSAEENEPSQAETAVEGDPSGVSGATVGRKSRRSRSESETSTMAMol wt: predicted mol wt 27 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°C Application: …
PrEST Antigen GALNT13
Product Name: PrEST Antigen GALNT13 Synonym: GalNAc-T13; KIAA1918 Product Type: Chemical CAS NO: 13647-35-3Protease_Inhibitor_Cocktail inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000144278Form: buffered aqueous solutionImmunogen sequence: ERSLLPALRAVISRNQEGPGEMGMol wt: predicted mol wt 20 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt …
PrEST Antigen THSD7B
Product Name: PrEST Antigen THSD7B Synonym: KIAA1679 Product Type: Chemical CAS NO: 20362-31-6Inhibitor_Kit inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000144229Form: buffered aqueous solutionImmunogen sequence: VLMESTGPAGHCPHLVESVPCEDPMCYRWLASEGICFPDHGKCGLGHRILKAVCQNDRGEDVSGSLCPVPPPPERKSCEIPCRMDCVLSEWMol wt: predicted mol wt 28 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt accession …
PrEST Antigen MALL
Product Name: PrEST Antigen MALL Synonym: BENE Product Type: Chemical CAS NO: 592542-59-1Toxins_for_Antibody-drug_conjugates_research_Library inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000144063Form: buffered aqueous solutionImmunogen sequence: SYLFGFYKRFESWRVLDSLYHGMol wt: predicted mol wt 20 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt accession …
PrEST Antigen RGS16
Product Name: PrEST Antigen RGS16 Synonym: A28-RGS14; RGS-r Product Type: Chemical CAS NO: 152121-53-4Smad_Compound_Library inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000143333Form: buffered aqueous solutionImmunogen sequence: QASAASATLSSCSLDEPSHTMol wt: predicted mol wt 20 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt …