Product Name: PrEST Antigen PTK7 Synonym: CCK4 Product Type: Chemical CAS NO: 1247-42-3Arenavirus inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000112655Form: buffered aqueous solutionImmunogen sequence: TAIVFIKQPSSQDALQGRRALLRCEVEAPGPVHVYWLLDGAPVQDTERRFAQGSSLSFAAVDRLQDSGTFQCVARDDVTGEEARSANASFNIKWIEAGPVVLKHPASEAEIQPQTQVTLRCHIDGHPRPTYQWFRMol wt: predicted mol wt 33 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt accession …
Author Archives: C14- demethylase
PrEST Antigen ERICH1
Product Name: PrEST Antigen ERICH1 Product Type: Chemical CAS NO: 29094-61-9Others inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000104714Form: buffered aqueous solutionImmunogen sequence: DASEEDPTWAGEEEGADSGEEDGADASEEDDTITNEKAHSILNFLKSTQEMYFYDGVSRDAASAALADAAEELLDRLASHSMLPSDVSILYHMKTLLLLQDTERLKHALEMFPEHCTMPPDHARVISAFFSYWITHMol wt: predicted mol wt 33 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt accession no.: Q86X53 …
PrEST Antigen NSF
Product Name: PrEST Antigen NSF Synonym: SKD2 Product Type: Chemical CAS NO: 142340-99-6Acids and Aldehydes inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000073969Form: buffered aqueous solutionImmunogen sequence: KVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMol wt: predicted mol wt 30 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: …
PrEST Antigen RAB3A
Product Name: PrEST Antigen RAB3A Product Type: Chemical CAS NO: 797-63-7Alkaloid inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000105649Form: buffered aqueous solutionImmunogen sequence: RIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVMol wt: predicted mol wt 34 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt accession no.: P20336 …
PrEST Antigen RAB3B
Product Name: PrEST Antigen RAB3B Product Type: Chemical CAS NO: 26807-65-8Terpenoids and Glycosides inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000169213Form: buffered aqueous solutionImmunogen sequence: RHEKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDMEEERVVPTEKGQLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSMLGSSKNTRLSDTPPLLQQMol wt: predicted mol wt 35 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt accession …
PrEST Antigen RPS6KA3
Product Name: PrEST Antigen RPS6KA3 Synonym: CLS; HU-3; MRX19; RSK; RSK2 Product Type: Chemical CAS NO: 71125-38-7Quinones inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000177189Form: buffered aqueous solutionImmunogen sequence: MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLYMol wt: predicted mol wt 34 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw …
PrEST Antigen TM4SF1
Product Name: PrEST Antigen TM4SF1 Synonym: L6; M3S1 Product Type: Chemical CAS NO: 50-24-8Saccharides and Glycosides inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000169908Form: buffered aqueous solutionImmunogen sequence: GPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVSLFSIMol wt: predicted mol wt 23 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage …
PrEST Antigen AGTR1
Product Name: PrEST Antigen AGTR1 Synonym: AG2S; AGTR1A; AGTR1B; AT1; AT1B Product Type: Chemical CAS NO: 93-14-1Cell_Counting_Kit-8 inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000144891Form: buffered aqueous solutionImmunogen sequence: LQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPMol wt: predicted mol wt 22 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw …
PrEST Antigen ABCC9
Product Name: PrEST Antigen ABCC9 Synonym: CMD1O; SUR2 Product Type: Chemical CAS NO: 66085-59-4Phosphatase_Inhibitor_Cocktail_II inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000069431Form: buffered aqueous solutionImmunogen sequence: QKLNEFLLSDEIGDDSWRTGESSLPFESCKKHTGVQPKTINRKQPGRYHLDSYEQSTRRLRPAETEDIAIKVTNGYFSWGSGLATLSNIDIRIPTGQLTMIVGQVGCGKSSLLLAILGEMQTLEGKVHWSNVNESEPMol wt: predicted mol wt 33 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt …
PrEST Antigen EMILIN1
Product Name: PrEST Antigen EMILIN1 Synonym: DKFZp586M121; gp115 Product Type: Chemical CAS NO: 5633-20-5Protease_Inhibitor_Cocktail_mini-Tablet inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000138080Form: buffered aqueous solutionImmunogen sequence: PQSIMYRRFLRPRYRVAYKTVTDMEWRCCQGYGGDDCAESPAPALGPASSTPRPLARPARPNLSGSSAGSPLSGLGGEGPGESEKVQQLEEQVQSLTKELQGLRGVLQGLSGRLAEDVQRAVETAFNGRQQPADAAARPGVHETLNEMol wt: predicted mol wt 33 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt …