Product Name: PrEST Antigen MRPS16 Synonym: CGI-132 Product Type: Chemical CAS NO: 137624-14-7Influenza Virus inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000182180Form: buffered aqueous solutionImmunogen sequence: ALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTMol wt: predicted mol wt 25 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt …
Author Archives: C14- demethylase
PrEST Antigen MRPS18B
Product Name: PrEST Antigen MRPS18B Synonym: C6orf14; HSPC183; MRPS18-2; PTD017 Product Type: Chemical CAS NO: 82692-96-4HIV inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000204568Form: buffered aqueous solutionImmunogen sequence: GLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPMol wt: predicted mol wt 27 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage …
PrEST Antigen MRPS18C
Product Name: PrEST Antigen MRPS18C Synonym: CGI-134; FLJ11146; FLJ22967; MRPS18-1 Product Type: Chemical CAS NO: 82611-85-6HBV inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000163319Form: buffered aqueous solutionImmunogen sequence: HVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRYRMol wt: predicted mol wt 26 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage …
PrEST Antigen MRPL1
Product Name: PrEST Antigen MRPL1 Synonym: BM022 Product Type: Chemical CAS NO: 18378-20-6Filovirus inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000169288Form: buffered aqueous solutionImmunogen sequence: NVEPFTSVLSLPYPFASEINKVAVFTENASEVKIAEENGAAFAGGTSLIQKIWDDEIVADFYVAVPEIMPELNRLRKKLNKKYPKLSRNSIGMol wt: predicted mol wt 28 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt accession …
PrEST Antigen RSL1D1
Product Name: PrEST Antigen RSL1D1 Synonym: CSIG; DKFZP564M182; L12; PBK1; UTP30 Product Type: Chemical CAS NO: 591778-68-6Bacterial inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000171490Form: buffered aqueous solutionImmunogen sequence: KERKKKRQQARKTASVLSKDDVAPESGDTTVKKPESKKEQTPEHGKKKRGRGKAQVKATNESEDEIPQLVPIGKKTPANEKVEIQKHATGKKSMol wt: predicted mol wt 28 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw …
PrEST Antigen MRPL46
Product Name: PrEST Antigen MRPL46 Product Type: Chemical CAS NO: 1217022-63-3Anti-infection inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000259494Form: buffered aqueous solutionImmunogen sequence: LAQDLEDMWEQKFLQFKLGARITEADEKNDRTSLNRKLDRNLVLLVREKFGDQDVWILPQAEWQPGETLRGTAERTLATLSEMol wt: predicted mol wt 27 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°C Application: Suitable as …
PrEST Antigen MRPS11
Product Name: PrEST Antigen MRPS11 Synonym: FLJ22512; FLJ23406; HCC-2 Product Type: Chemical CAS NO: 979-88-4Acids and Aldehydes inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000181991Form: buffered aqueous solutionImmunogen sequence: SRFLRSWTWPQTAGRVVARTPAGTICTGARQLQDAAAKQKVEQNAAPSHTKFSIYPPIPGEESSLRWAGKKFEEIPIAHIKASHNNTQIQVVSASNEPMol wt: predicted mol wt 28 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw …
PrEST Antigen RPL8
Product Name: PrEST Antigen RPL8 Synonym: L8 Product Type: Chemical CAS NO: 59-14-3Alkaloid inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000161016Form: buffered aqueous solutionImmunogen sequence: VISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVRGVAMNPVEHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKMol wt: predicted mol wt 28 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt accession …
PrEST Antigen MRPL11
Product Name: PrEST Antigen MRPL11 Product Type: Chemical CAS NO: 7411-49-6Terpenoids and Glycosides inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000174547Form: buffered aqueous solutionImmunogen sequence: PTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRMol wt: predicted mol wt 25 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt accession …
PrEST Antigen MRPS9
Product Name: PrEST Antigen MRPS9 Synonym: MRP-S9; RPMS9; S9mt Product Type: Chemical CAS NO: 54970-72-8Quinones inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000135972Form: buffered aqueous solutionImmunogen sequence: RLRHTAFVIPKKNVPTSKRETYTEDFIKKQIEEFNIGKRHLANMMGEDPETFTQEDIDRAIAYLFPSGLFEKRARPVMKHPEMol wt: predicted mol wt 27 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: …