Product Name: PrEST Antigen CCDC12 Synonym: MGC23918 Product Type: Chemical CAS NO: 1189922-23-3HBV inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000160799Form: buffered aqueous solutionImmunogen sequence: EALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKMol wt: predicted mol wt 27 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°C Application: …
Author Archives: C14- demethylase
PrEST Antigen KIF26A
Product Name: PrEST Antigen KIF26A Synonym: DKFZP434N178; KIAA1236 Product Type: Chemical CAS NO: 1189904-01-5Filovirus inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000066735Form: buffered aqueous solutionImmunogen sequence: PVGMSGQVAGSPMLPGATCPRLAAGSRCPERGLLTTTVTLQRPVELNGEDMol wt: predicted mol wt 23 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°C …
PrEST Antigen ACTL6B
Product Name: PrEST Antigen ACTL6B Synonym: ACTL6; BAF53B Product Type: Chemical CAS NO: 6809-52-5Bacterial inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000077080Form: buffered aqueous solutionImmunogen sequence: CPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVMol wt: predicted mol wt 22 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt …
PrEST Antigen FNIP2
Product Name: PrEST Antigen FNIP2 Synonym: FNIPL; KIAA1450 Product Type: Chemical CAS NO: 442908-10-3Anti-infection inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000052795Form: buffered aqueous solutionImmunogen sequence: MDQQAVCELLKVEMPTRLPDRSVAWPCPDRHLREKPSLEKVTFQIGSFASPESDFESRMKKMEERVKACGPSLEASEAADVAQDPQVSRSPMol wt: predicted mol wt 28 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt …
PrEST Antigen UQCRB
Product Name: PrEST Antigen UQCRB Synonym: QCR7; QP-C; UQBP; UQCR6 Product Type: Chemical CAS NO: 1398044-45-5Acids and Aldehydes inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000156467Form: buffered aqueous solutionImmunogen sequence: LPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKKMol wt: predicted mol wt 25 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated …
PrEST Antigen CYB561A3
Product Name: PrEST Antigen CYB561A3 Product Type: Chemical CAS NO: 1261395-96-3Alkaloid inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000162144Form: buffered aqueous solutionImmunogen sequence: ILLASSWKRPEPGILTDRQPLLHDGEMol wt: predicted mol wt 21 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°C Application: Suitable as …
PrEST Antigen ABI3BP
Product Name: PrEST Antigen ABI3BP Synonym: DKFZP586L2024; NESHBP; TARSH Product Type: Chemical CAS NO: Terpenoids and Glycosides inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000154175Form: buffered aqueous solutionImmunogen sequence: VEGGIWSKIFNHKTVVGSKKVNGKIQSTYDQDHTVPAYVPRKLIPITIIKQVIQNVTHKDSAKSPEKAPLGGVILVHLIIPGLNETTVKLPASLMFEISDALMol wt: predicted mol wt 29 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw …
PrEST Antigen C14orf2
Product Name: PrEST Antigen C14orf2 Synonym: MP68 Product Type: Chemical CAS NO: Quinones inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000156411Form: buffered aqueous solutionImmunogen sequence: PMKPYYTKVYQEIWIGMGLMGFIVYKIRAADKRSKALKASAPAPGHHMol wt: predicted mol wt 23 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt accession …
PrEST Antigen CCDC58
Product Name: PrEST Antigen CCDC58 Synonym: FLJ33273 Product Type: Chemical CAS NO: Saccharides and Glycosides inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000160124Form: buffered aqueous solutionImmunogen sequence: PSGGVNCEEFAEFQELLKVMRTIDDRIVHELNTTVPTASFAGKIDASQTCKQLYESLMAAHASRDRVIMol wt: predicted mol wt 25 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: …
PrEST Antigen LSM12
Product Name: PrEST Antigen LSM12 Synonym: FLJ30656 Product Type: Chemical CAS NO: 303727-31-3Cell_Counting_Kit-8 inhibitorsAssay: >80% (SDS-PAGE)Concentration: ≥0.5 mg/mLConjugate: His taggedEnsembl | human accession no.: ENSG00000161654Form: buffered aqueous solutionImmunogen sequence: PGEYFSVGSQVSCRTCQEQRLQGEVVAFDYQSKMLALKCPSSSGKPNHADILLINLQYVSEVEIINDRTETPPPLASLNVSKMol wt: predicted mol wt 27 kDaPurified by: immobilized metal affinity chromatography (IMAC)Recombinant: expressed in E. coliShipped in: wet iceStorage condition: avoid repeated freeze/thaw cyclesStorage temp.: −20°CUniProt accession …