C14-demethylase

Product Name: PrEST Antigen CBX4

Synonym: NBP16; PC2; hPC2

Product Type: Chemical

CAS NO: 67227-56-9Interleukin Related inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000141582
Form: buffered aqueous solution
Immunogen sequence: SPKYNTWEPEENILDPRLLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTDNRAKLDSGAEEK
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: O00257
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human CBX4withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA012021.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/310/2/752

Product Name: PrEST Antigen C5orf15

Synonym: HTGN29; KCT2

Product Type: Chemical

CAS NO: 70052-12-9FLAP inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000113583
Form: buffered aqueous solution
Immunogen sequence: PSPTVLNSHISTPNVNALTHENQTKPSISQISTTLPPTTSTKKSGGASVVPHPSPTPLSQEEADNNEDPSIEEEDLLMLNSSPSTAKDTLDNGDYGEPDYDWTTGPRDDDESDDTLEENRGYMEIEQSVK
Mol wt: predicted mol wt 32 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q8NC54
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human C5orf15withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA011951.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/310/2/745

Product Name: PrEST Antigen TRAK1

Synonym: KIAA1042; MILT1; OIP106

Product Type: Chemical

CAS NO: 68278-23-9COX inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000182606
Form: buffered aqueous solution
Immunogen sequence: CTPRRLSLAESFTNTRESTTTMSTSLGLVWLLKERGISAAVYDPQSWDRAGRGSLLHSYTPKMAVIPSTPPNSPMQTPTSSPPSFEFKCTSPPYDNFLASKPASSILREVREKNVRSSESQTDVSVSNLNLVD
Mol wt: predicted mol wt 32 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q9UPV9
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human TRAK1withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA011367.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/310/2/737

Product Name: PrEST Antigen MGAT5B

Synonym: FLJ25132; GnT-IX; GnT-VB

Product Type: Chemical

CAS NO: 72496-41-4Complement System inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000167889
Form: buffered aqueous solution
Immunogen sequence: RTKRLTAQWALAAQRLAQKLGATQRDQKQILVHIGFLTEESGDVFSPRVLKGGPLGEMVQWADILTALYVLGHGLRVTVSLKELQSNLGVPPGRGSCPLTMPLPFDLIYTDYHGLQQMKRHMGLSFKKYRCRIRVID
Mol wt: predicted mol wt 33 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q3V5L5
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human MGAT5BwithN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA011082.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/310/2/728

Product Name: PrEST Antigen HNF4G

Synonym: NR2A2

Product Type: Chemical

CAS NO: 1134-47-0Immunology_Inflammation inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000164749
Form: buffered aqueous solution
Immunogen sequence: PAFCELPLDDQVALLRAHAGEHLLLGATKRSMMYKDILLLGNNYVIHRNSCEVEISRVANRVLDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPVKIKNMRFQVQIGL
Mol wt: predicted mol wt 30 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q14541
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human HNF4GwithN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA010610.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/310/2/718

Product Name: PrEST Antigen ALOX15B

Synonym: 15-LOX-2

Product Type: Chemical

CAS NO: 957135-43-2Vasopressin Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000179593
Form: buffered aqueous solution
Immunogen sequence: FRAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPEDVGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQEGTAKVSWAD
Mol wt: predicted mol wt 30 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: O15296
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human ALOX15BwithN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA010562.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/310/2/710

Product Name: PrEST Antigen VAX2

Synonym: DRES93

Product Type: Chemical

CAS NO: 103733-65-9Urotensin Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000116035
Form: buffered aqueous solution
Immunogen sequence: RRAESGGGGGRCGDRSGAGDLRADGGGHSPTEVAGTSASSPAGSRESGADSDGQPGPGEADHCRRILVRDAKGTIREIVLPKGLDLDRPKRT
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q9UIW0
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human VAX2withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA009708.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/310/2/703

Product Name: PrEST Antigen ATP7B

Synonym: WND

Product Type: Chemical

CAS NO: 122341-38-2Somatostatin Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000123191
Form: buffered aqueous solution
Immunogen sequence: ATVLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNHSAGNSMVQTTDGTPTSVQEVAPHTGRLPANHAPDILAKSPQSTRAVAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLV
Mol wt: predicted mol wt 30 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: P35670
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human ATP7BwithN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA009137.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/310/2/695

Product Name: PrEST Antigen IMPG2

Synonym: IPM200; RP56

Product Type: Chemical

CAS NO: 127373-66-4Sigma Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000081148
Form: buffered aqueous solution
Immunogen sequence: LQAHHDRSERESPFSGSSRQPDSLSSIENAVKYNPVYESHRAGCEKYEGPYPQHPFYSSASGDVIGGLSREEIRQMYESSELSREEIQERMRVLELYANDPEFAAFVR
Mol wt: predicted mol wt 30 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q9BZV3
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human IMPG2withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA008779.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/310/2/687

Product Name: PrEST Antigen PLCB4

Product Type: Chemical

CAS NO: 150374-95-1RGS Protein inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000101333
Form: buffered aqueous solution
Immunogen sequence: SLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQSSSELRPTTTAALASGVEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKL
Mol wt: predicted mol wt 34 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q15147
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human PLCB4withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA007951.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/310/2/678