C14-demethylase

Product Name: PrEST Antigen BLOC1S5

Synonym: MU; MUTED; dJ303A1.3

Product Type: Chemical

CAS NO: 4382-63-2Histone Demethylase inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000188428
Form: buffered aqueous solution
Immunogen sequence: MSGGGTETPVGCEAAPGGGSKKRDSLGTAGSAHLIIKDLGEIHSRLLDHRPVIQGETRYFVKEFEEKRGLREMRVLE
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q8TDH9
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human BLOC1S5withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA077525.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/310/1/417

Product Name: PrEST Antigen PI4K2A

Synonym: DKFZP761G1923; PI4KII; PIK42A

Product Type: Chemical

CAS NO: 591778-68-6Histone Acetyltransferase inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000155252
Form: buffered aqueous solution
Immunogen sequence: ALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW
Mol wt: predicted mol wt 23 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q9BTU6
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human PI4K2AwithN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA076857.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/310/1/407

Product Name: PrEST Antigen MS4A6E

Product Type: Chemical

CAS NO: 315704-66-6Epigenetic Reader Domain inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000166926
Form: buffered aqueous solution
Immunogen sequence: NETIIMLPSNVINFSQAEKPEPTNQGQDSLKKRL
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q96DS6
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human MS4A6EwithN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA076623.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/310/1/395

Product Name: PrEST Antigen GALNT4

Synonym: GalNAc-T4

Product Type: Chemical

CAS NO: 1217022-63-3DNA Methyltransferase inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000257594
Form: buffered aqueous solution
Immunogen sequence: IRFNSVTELCAEVPEQKNYVGMQNCPKDGFPVPANIIWHFKEDGTIFHPHSGLCLSAYRTPEGRPDVQMRTCDA
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q8N4A0
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human GALNT4withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA076116.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/310/1/386

Product Name: PrEST Antigen GPR89A

Synonym: UNQ192

Product Type: Chemical

CAS NO: 894783-71-2AMPK inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000117262
Form: buffered aqueous solution
Immunogen sequence: LGDPFPILSPKHGILSIEQL
Mol wt: predicted mol wt 20 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: B7ZAQ6
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human GPR89AwithN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA076096.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/310/1/376

Product Name: PrEST Antigen SERF1A

Synonym: 4F5; FAM2A; H4F5; SERF1; SMAM1

Product Type: Chemical

CAS NO: 979-88-4Epigenetics inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000172058
Form: buffered aqueous solution
Immunogen sequence: SSGGQKSESKMSAGPHLPLKAPRENPCFPLPAAGGSR
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: O75920
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human SERF1AwithN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA075271.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/310/1/367

Product Name: PrEST Antigen PALM2

Product Type: Chemical

CAS NO: 1708766Myosin inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000243444
Form: buffered aqueous solution
Immunogen sequence: TKVVYEVRSGGTVVENGVHKLSTKDVEELIQKAGQSSLGGGHVSERTVIADGSLSHPKEHMLCKEAKLEMVHKSRKDHSSGNPGQQ
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q8IXS6
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human PALM2withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA074153.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/310/1/359

Product Name: PrEST Antigen AKR1B10

Synonym: AKR1B11; AKR1B12; ALDRLn; ARL-1; ARL1; HIS; HSI

Product Type: Chemical

CAS NO: 59-14-3Integrin inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000198074
Form: buffered aqueous solution
Immunogen sequence: FKLSDEEMATILSFNRNWRACNVLQ
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: O60218
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human AKR1B10withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA073633.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/310/1/349

Product Name: PrEST Antigen CDK11A

Synonym: CDC2L2; CDC2L3; CDK11-p110; CDK11-p46; CDK11-p58; PITSLRE; p58GTA

Product Type: Chemical

CAS NO: 157843-41-9Gap Junction Protein inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000008128
Form: buffered aqueous solution
Immunogen sequence: MNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHL
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q9UQ88
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human CDK11AwithN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA073626.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/310/1/342

Product Name: PrEST Antigen NACA

Synonym: NACA1

Product Type: Chemical

CAS NO: 7411-49-6Dynamin inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000196531
Form: buffered aqueous solution
Immunogen sequence: MPGEATETVPATEQELPQPQAETGSGT
Mol wt: predicted mol wt 20 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q13765
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human NACAwithN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA073152.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/310/1/334