PrEST Antigen GCGR

Product Name: PrEST Antigen GCGR

Synonym: GGR

Product Type: Chemical

CAS NO: 1604810-83-4GPR119 inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000215644
Form: buffered aqueous solution
Immunogen sequence: AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISC
Mol wt: predicted mol wt 24 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: P47871
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human GCGRwithN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA071228.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/309/3/1020

PrEST Antigen SEMA6C

Product Name: PrEST Antigen SEMA6C

Synonym: KIAA1869

Product Type: Chemical

CAS NO: GPR109A inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000143434
Form: buffered aqueous solution
Immunogen sequence: RSCLASQDPYCGWHSSRGCVDIRGSGGTDVDQAGNQESMEHGDCQDGATGSQSGPGDSAYVLPGPGPSPGTPSPPSDAHPRPQSSTL
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q9H3T2
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human SEMA6CwithN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA071220.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/309/3/1011

PrEST Antigen DOT1L

Product Name: PrEST Antigen DOT1L

Synonym: DOT1; KIAA1814; KMT4

Product Type: Chemical

CAS NO: 84088-42-6GPCR19 inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000104885
Form: buffered aqueous solution
Immunogen sequence: LIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETS
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q8TEK3
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human DOT1LwithN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA071217.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/309/3/1003

PrEST Antigen EPHB2

Product Name: PrEST Antigen EPHB2

Synonym: DRT; EPHT3; ERK; Hek5; Tyro5

Product Type: Chemical

CAS NO: 432001-69-9GNRH Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000133216
Form: buffered aqueous solution
Immunogen sequence: CRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVI
Mol wt: predicted mol wt 24 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: P29323
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human EPHB2withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA071200.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/309/3.cover-expansion

PrEST Antigen PRKACA

Product Name: PrEST Antigen PRKACA

Synonym: PKACa

Product Type: Chemical

CAS NO: 75629-57-1Glucocorticoid Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000072062
Form: buffered aqueous solution
Immunogen sequence: KQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVP
Mol wt: predicted mol wt 23 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: P17612
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human PRKACAwithN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA071185.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/309/2/845

PrEST Antigen SCAMP3

Product Name: PrEST Antigen SCAMP3

Synonym: C1orf3

Product Type: Chemical

CAS NO: 328998-25-0Glucagon Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000116521
Form: buffered aqueous solution
Immunogen sequence: MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEP
Mol wt: predicted mol wt 24 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: O14828
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human SCAMP3withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA071167.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/309/2/833

PrEST Antigen SLCO1A2

Product Name: PrEST Antigen SLCO1A2

Synonym: OATP; OATP-A; OATP1A2; SLC21A3

Product Type: Chemical

CAS NO: 431979-47-4Endothelin Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000084453
Form: buffered aqueous solution
Immunogen sequence: FLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYGITKDFLPFMKSLSCN
Mol wt: predicted mol wt 24 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: P46721
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human SLCO1A2withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA071152.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/309/2/825

PrEST Antigen FICD

Product Name: PrEST Antigen FICD

Synonym: HIP13; HYPE

Product Type: Chemical

CAS NO: 677331-12-3EBI2_GPR183 inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000198855
Form: buffered aqueous solution
Immunogen sequence: VKKVMSIPKGNSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISD
Mol wt: predicted mol wt 28 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q9BVA6
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human FICDwithN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA071134.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/309/2/816

PrEST Antigen PTPRR

Product Name: PrEST Antigen PTPRR

Synonym: EC-PTP; PCPTP1; PTP-SL; PTPBR7; PTPRQ

Product Type: Chemical

CAS NO: 28755-03-5Dopamine Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000153233
Form: buffered aqueous solution
Immunogen sequence: ERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIKATTATSVCPSPFK
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q15256
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human PTPRRwithN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA071067.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/309/2/804

PrEST Antigen COLEC12

Product Name: PrEST Antigen COLEC12

Synonym: CL-P1; SCARA4; SRCL

Product Type: Chemical

CAS NO: 353519-63-8CXCR inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000158270
Form: buffered aqueous solution
Immunogen sequence: GYKVVEKMDNVTGGMETSRQTYDDKLTAVESDLKKLGDQTGKKAISTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKLQ
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q5KU26
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human COLEC12withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA071056.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/309/2/796