C14-demethylase

Product Name: PrEST Antigen STX12

Synonym: STX13; STX14

Product Type: Chemical

CAS NO: 1191911-27-9Aminopeptidase inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000117758
Form: buffered aqueous solution
Immunogen sequence: KERLMNDFSAALNNFQAVQRRVSEKEKESIARARAGSRLSAEERQREEQLVSFDSHEEWNQMQSQEDEVAITEQDLELIKERET
Mol wt: predicted mol wt 28 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q86Y82
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human STX12withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA055300.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/306/3/941

Product Name: PrEST Antigen ARHGEF9

Synonym: KIAA0424; PEM-2

Product Type: Chemical

CAS NO: 57644-54-9Aldehyde Dehydrogenase (ALDH) inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000131089
Form: buffered aqueous solution
Immunogen sequence: VPPSYPPPQDPLNHGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK
Mol wt: predicted mol wt 24 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: O43307
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human ARHGEF9withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA055291.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/306/3/934

Product Name: PrEST Antigen DTX1

Synonym: hDx-1

Product Type: Chemical

CAS NO: 54350-48-0Adenosine Kinase inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000135144
Form: buffered aqueous solution
Immunogen sequence: PPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPP
Mol wt: predicted mol wt 23 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q86Y01
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human DTX1withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA055275.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/306/3/925

Product Name: PrEST Antigen FRAT1

Product Type: Chemical

CAS NO: 632-85-9Adenosine Deaminase inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000165879
Form: buffered aqueous solution
Immunogen sequence: PQADLDGPPGAGKQGIPQPLS
Mol wt: predicted mol wt 20 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q92837
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human FRAT1withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA055258.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/306/3/914

Product Name: PrEST Antigen GJB4

Synonym: CX30.3

Product Type: Chemical

CAS NO: 31431-39-75-Lipoxygenase inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000189433
Form: buffered aqueous solution
Immunogen sequence: RLYKDYDMPRVVACSVEPCPHTVDCYISR
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q9NTQ9
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human GJB4withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA055112.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/306/3/903

Product Name: PrEST Antigen NRP2

Synonym: VEGF165R2

Product Type: Chemical

CAS NO: 1174046-72-015-PGDH inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000118257
Form: buffered aqueous solution
Immunogen sequence: PSGFNCNFDFLEEPCGWMYDHAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYARLISPPVHLPRSPVCMEFQY
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: O60462
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human NRP2withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA054974.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/306/3/889

Product Name: PrEST Antigen GPATCH3

Synonym: FLJ12455; GPATC3

Product Type: Chemical

CAS NO: 1454846-35-5Metabolic Enzyme_Protease inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000198746
Form: buffered aqueous solution
Immunogen sequence: RHTKGIGRKVMERQGWAEGQGLGCRCSGVPEALDSDGQHPRCKRGLGYHGEKLQPFGQLKRPRRNGLGLISTIYDEPLPQDQTES
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q96I76
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human GPATCH3withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA054973.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/306/3/880

Product Name: PrEST Antigen SLFNL1

Synonym: FLJ23878

Product Type: Chemical

CAS NO: 873786-09-5VDAC inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000171790
Form: buffered aqueous solution
Immunogen sequence: TRNMEFKRGSGEYLSLAFKHHVRRYVCAFLNSEGGSLLVGVEDSGLVQGIRCSHRDEDRARLLVDSILQGFKPQIFPDAYTLTFIPVISTSETS
Mol wt: predicted mol wt 28 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q499Z3
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human SLFNL1withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA054956.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/306/3/870

Product Name: PrEST Antigen PSMB7

Product Type: Chemical

CAS NO: 1373423-53-0TRP Channel inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000136930
Form: buffered aqueous solution
Immunogen sequence: LVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTM
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q99436
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human PSMB7withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA054902.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/306/3/861

Product Name: PrEST Antigen TMCO1

Synonym: HP10122; TMCC4

Product Type: Chemical

CAS NO: 944842-54-0SGLT inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000143183
Form: buffered aqueous solution
Immunogen sequence: RQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q9UM00
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human TMCO1withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA054768.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/306/3/855