PrEST Antigen NIP7

Product Name: PrEST Antigen NIP7

Synonym: CGI-37; FLJ10296; HSPC031; KD93

Product Type: Chemical

CAS NO: 911714-45-9SGK inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000132603
Form: buffered aqueous solution
Immunogen sequence: APYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
Mol wt: predicted mol wt 28 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q9Y221
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human NIP7withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA040856.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/305/2/507

PrEST Antigen CAMK2G

Product Name: PrEST Antigen CAMK2G

Synonym: CAMKG

Product Type: Chemical

CAS NO: 185517-74-2ROR inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000148660
Form: buffered aqueous solution
Immunogen sequence: NSLVSPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAAPLRTGNGSSVPEGRSSR
Mol wt: predicted mol wt 25 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q13555
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human CAMK2GwithN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA040656.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/305/2/502

PrEST Antigen CCDC89

Product Name: PrEST Antigen CCDC89

Synonym: FLJ38159

Product Type: Chemical

CAS NO: 668463-35-2RAR_RXR inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000179071
Form: buffered aqueous solution
Immunogen sequence: PEERLEKQNEKLNNQEEETEFKELDGLREALANLRGLSEEERSEKAMLRSRIEEQSQLICILKRRSDEALERCQILELLNAELEEKMMQE
Mol wt: predicted mol wt 28 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q8N998
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human CCDC89withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA040628.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/305/2/495

PrEST Antigen EEF2

Product Name: PrEST Antigen EEF2

Synonym: EEF-2; EF2

Product Type: Chemical

CAS NO: 661-19-8Proteasome inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000167658
Form: buffered aqueous solution
Immunogen sequence: CIPIKKSDPVVSYRETVSEESNVLCLSKSPNKHNRLYMKARPFPDGLAEDIDKGEVSARQELKQRARYLAEKYEWDVAEARKIWCFG
Mol wt: predicted mol wt 28 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: P13639
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human EEF2withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA040534.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/305/2/482

PrEST Antigen APOD

Product Name: PrEST Antigen APOD

Product Type: Chemical

CAS NO: 75738-58-8Procollagen C Proteinase inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000189058
Form: buffered aqueous solution
Immunogen sequence: GKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGE
Mol wt: predicted mol wt 25 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: P05090
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human APODwithN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA040520.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/305/2/474

PrEST Antigen WDR82

Product Name: PrEST Antigen WDR82

Synonym: MST107; MSTP107; PRO2730; PRO34047; SWD2; TMEM113; WDR82A

Product Type: Chemical

CAS NO: 7554-65-6Phospholipase inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000164091
Form: buffered aqueous solution
Immunogen sequence: GYANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGKHTGPITCLQFNPKFMTFASACSNMAFWLPTIDD
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q6UXN9
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human WDR82withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA040427.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/305/2/467

PrEST Antigen SPG21

Product Name: PrEST Antigen SPG21

Synonym: ACP33; BM-019; GL010; MAST

Product Type: Chemical

CAS NO: 3093-35-4Phosphodiesterase (PDE) inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000090487
Form: buffered aqueous solution
Immunogen sequence: AKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQEEQ
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q9NZD8
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human SPG21withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA040407.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/305/2/460

PrEST Antigen GLYAT

Product Name: PrEST Antigen GLYAT

Synonym: ACGNAT; GAT

Product Type: Chemical

CAS NO: 66852-54-8PGC-1(alpha) inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000149124
Form: buffered aqueous solution
Immunogen sequence: DQTGEMRMAGTLPEYRLHGLVTYVIYSHAQKLGKLGFPVYSHVDYSNEAMQKMSYTLQHVPIPRSWNQWNCVPL
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q6IB77
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human GLYATwithN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA040251.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/305/2/451

PrEST Antigen ZDHHC16

Product Name: PrEST Antigen ZDHHC16

Synonym: APH2

Product Type: Chemical

CAS NO: 968-81-0PDHK inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000171307
Form: buffered aqueous solution
Immunogen sequence: LFREAYAAIEKMKQLDKNKLQAVANQTYHQTPPPTFSFRERMTHK
Mol wt: predicted mol wt 23 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: Q969W1
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human ZDHHC16withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA040214.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/305/2/440

PrEST Antigen RHOBTB1

Product Name: PrEST Antigen RHOBTB1

Synonym: KIAA0740

Product Type: Chemical

CAS NO: 6018-19-5Neprilysin inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Ensembl | human accession no.: ENSG00000072422
Form: buffered aqueous solution
Immunogen sequence: LMECEESPNGSEGACEKEKQSRDFQGRILSVDPEEEREEGPPRIPQADQWKSSNKSLVEALGLEAEGAVPE
Mol wt: predicted mol wt 25 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage temp.: −20°C
UniProt accession no.: O94844
Application: Blocking agent and positive assay control using corresponding antibodies.
General description: Recombinant protein fragment of Human RHOBTB1withN-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Linkage: Corresponding Antibody HPA040205.
Physical Form: Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/305/2/434