PrEST Antigen RD3L

Product Name: PrEST Antigen RD3L

Synonym: TDRD9-AS1; TDRD9AS1

Product Type: Chemical

CAS NO: 16816-67-4PGC-1(alpha) inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000227729
Form: buffered aqueous solution
Immunogen sequence: VLKDFLSSSDRGSEQEDLEDSGSMDCSAPSVIQGDSSKRADKDEIPTISSYVDKNTKDRFPVFSHRIWNL
Mol wt: predicted mol wt 25 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P0DJH9
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human RD3L
Linkage: Corresponding Antibody HPA067971.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/304/1/294

PrEST Antigen SLC12A5

Product Name: PrEST Antigen SLC12A5

Synonym: KCC2; KIAA1176

Product Type: Chemical

CAS NO: 23672-07-3PAI-1 inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000124140
Form: buffered aqueous solution
Immunogen sequence: ILKQMHLTKNEREREIQSITDESRGSIRRKNPANTRLRLNVPEETAGDSEEKPEEEVQLIHDQSAPSC
Mol wt: predicted mol wt 25 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9H2X9
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human SLC12A5
Linkage: Corresponding Antibody HPA072058.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/304/1/284

PrEST Antigen C6orf1

Product Name: PrEST Antigen C6orf1

Synonym: LBH; MGC57858

Product Type: Chemical

CAS NO: 26002-80-2NEDD8-activating Enzyme inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000186577
Form: buffered aqueous solution
Immunogen sequence: CWVLGLHFSLHPPSAASASHALTITSLPPGLLPFVGVELTAHPQALMGRGFPSGMGAAGRHLCFL
Mol wt: predicted mol wt 24 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human C6orf1
Linkage: Corresponding Antibody HPA037659.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/304/1/277

PrEST Antigen NACC1

Product Name: PrEST Antigen NACC1

Synonym: BEND8; BTBD14B; BTBD30; NAC-1; NAC1

Product Type: Chemical

CAS NO: 26016-98-8MMP inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000160877
Form: buffered aqueous solution
Immunogen sequence: RVVRKSWMPKVKVLKAEDDAYTTFISETGKIEPDMMGVEHGFETASHEGEAGPSAEAL
Mol wt: predicted mol wt 24 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q96RE7
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human NACC1
Linkage: Corresponding Antibody HPA062245.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/304/1/272

PrEST Antigen PLG

Product Name: PrEST Antigen PLG

Product Type: Chemical

CAS NO: 2668-66-8Mineralocorticoid Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000122194
Form: buffered aqueous solution
Immunogen sequence: NYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCY
Mol wt: predicted mol wt 24 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P00747
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human PLG
Linkage: Corresponding Antibody HPA048823.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/304/1/266

PrEST Antigen VSIG2

Product Name: PrEST Antigen VSIG2

Synonym: CTH; CTXL

Product Type: Chemical

CAS NO: 99-15-0MAGL inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000019102
Form: buffered aqueous solution
Immunogen sequence: GKKPKETYGGSDLREDAIAPGISEHTCMRADSSKGFLERPSSASTVTTTKSKLPMVV
Mol wt: predicted mol wt 24 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q96IQ7
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human VSIG2
Linkage: Corresponding Antibody HPA050147.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/304/1/254

PrEST Antigen DENND2C

Product Name: PrEST Antigen DENND2C

Synonym: DKFZp686G0351; DKFZp779P1149; FLJ37099; RP5-1156J9.1; dJ1156J9.1

Product Type: Chemical

CAS NO: 1165910-22-4LXR inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000175984
Form: buffered aqueous solution
Immunogen sequence: WEGRANGISNPEKWCPKDFGVRYNCHQEIRLKKNPIAERKSKNLDVTSRENVGLDINENTKSHDQSENENKKHEYDDTHFFKNESESNWVCSRVKEIESCKED
Mol wt: predicted mol wt 30 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q68D51
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human DENND2C
Linkage: Corresponding Antibody HPA054955.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/304/1/246

PrEST Antigen CELSR1

Product Name: PrEST Antigen CELSR1

Synonym: CDHF9; FMI2; HFMI2; ME2

Product Type: Chemical

CAS NO: 17230-88-5Indoleamine 23-Dioxygenase (IDO) inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000075275
Form: buffered aqueous solution
Immunogen sequence: PTSFRLQILNNYLQFEVSHGPSDVESVMLSGLRVTDGEWHHLLIELKNVKEDSEMKHLVTMTLDYGMDQNKADIGGMLPGLTVRSVVV
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9NYQ6
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human CELSR1
Linkage: Corresponding Antibody HPA067269.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/304/1/238

PrEST Antigen RPL29

Product Name: PrEST Antigen RPL29

Synonym: HIP; HUMRPL29; L29; RPL29P10

Product Type: Chemical

CAS NO: 17575-22-3HMG-CoA Reductase (HMGCR) inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000162244
Form: buffered aqueous solution
Immunogen sequence: PASVPAQAPKRTQAPTKASE
Mol wt: predicted mol wt 20 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P47914
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human RPL29
Linkage: Corresponding Antibody HPA069064.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/304/1/229

PrEST Antigen TRDN

Product Name: PrEST Antigen TRDN

Product Type: Chemical

CAS NO: 17692-51-2HIV Protease inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000186439
Form: buffered aqueous solution
Immunogen sequence: TEITAEGNASTTTTVIDSKNGSVPKSPGKVLKRTVTEDIVTTF
Mol wt: predicted mol wt 22 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human TRDN
Linkage: Corresponding Antibody HPA058226.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/304/1/223