C14-demethylase

Product Name: PrEST Antigen ZMYND19

Synonym: MIZIP

Product Type: Chemical

CAS NO: 1435-55-85-Lipoxygenase inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000165724
Form: buffered aqueous solution
Immunogen sequence: PGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQFPVLNVTRYYNANG
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q96E35
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human ZMYND19
Linkage: Corresponding Antibody HPA050761.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/985

Product Name: PrEST Antigen NSMCE2

Synonym: C8orf36; FLJ32440; MMS21; NSE2; ZMIZ7

Product Type: Chemical

CAS NO: 150-38-95 alpha Reductase inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000156831
Form: buffered aqueous solution
Immunogen sequence: QNNEKFVQFKQQLKELKKQCGLQADREADGTEGVDEDIIVTQS
Mol wt: predicted mol wt 23 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q96MF7
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human NSMCE2
Linkage: Corresponding Antibody HPA065734.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/979

Product Name: PrEST Antigen TSPAN5

Synonym: NET-4; TM4SF9; Tspan-5

Product Type: Chemical

CAS NO: 15302-15-515-PGDH inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000168785
Form: buffered aqueous solution
Immunogen sequence: ARQKPEVDQQIVIYTKGCVP
Mol wt: predicted mol wt 20 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P62079
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human TSPAN5
Linkage: Corresponding Antibody HPA067655.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/969

Product Name: PrEST Antigen SSU72

Synonym: HSPC182

Product Type: Chemical

CAS NO: 16485-10-2VDAC inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000160075
Form: buffered aqueous solution
Immunogen sequence: YDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEER
Mol wt: predicted mol wt 24 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9NP77
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human SSU72
Linkage: Corresponding Antibody HPA069290.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/959

Product Name: PrEST Antigen ANKRD54

Synonym: LIAR

Product Type: Chemical

CAS NO: 27912-14-7URAT1 inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000100124
Form: buffered aqueous solution
Immunogen sequence: RSGHSSSEGECAVAPEPLTDAEGLFSFADFGSALGGGGAGLSGRASGGAQSPLRYLHVLWQQDAEP
Mol wt: predicted mol wt 24 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q6NXT1
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human ANKRD54
Linkage: Corresponding Antibody HPA071287.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/952

Product Name: PrEST Antigen TMX2

Synonym: PDIA12; TXNDC14

Product Type: Chemical

CAS NO: 1949-20-8Sodium Channel inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000213593
Form: buffered aqueous solution
Immunogen sequence: ENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK
Mol wt: predicted mol wt 23 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9Y320
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human TMX2
Linkage: Corresponding Antibody HPA063763.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/945

Product Name: PrEST Antigen EIF2S1

Synonym: EIF-2alpha; EIF2; EIF2A

Product Type: Chemical

CAS NO: 210353-53-0Proton Pump inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000134001
Form: buffered aqueous solution
Immunogen sequence: IAPPRYVMTTTTLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEVDG
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P05198
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human EIF2S1
Linkage: Corresponding Antibody HPA064885.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/937

Product Name: PrEST Antigen TPM1

Synonym: C15orf13; CMH3

Product Type: Chemical

CAS NO: 23327-57-3P2X Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000140416
Form: buffered aqueous solution
Immunogen sequence: LNRRIQLVEEELDRAQERLATALQKLEE
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P09493
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human TPM1
Linkage: Corresponding Antibody HPA053624.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/928

Product Name: PrEST Antigen ATP5F1

Product Type: Chemical

CAS NO: 2438-32-6NKCC inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000116459
Form: buffered aqueous solution
Immunogen sequence: LDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM
Mol wt: predicted mol wt 25 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P24539
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human ATP5F1
Linkage: Corresponding Antibody HPA057347.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/919

Product Name: PrEST Antigen HMG20B

Synonym: BRAF25; BRAF35; HMGX2; HMGXB2; SMARCE1r; SOXL

Product Type: Chemical

CAS NO: 201256nAChR inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000064961
Form: buffered aqueous solution
Immunogen sequence: GFVVTVKQERGEGPRAGEKGSHEEEPVKKRGWPKGKKRKKILPNGPKAPVTGYV
Mol wt: predicted mol wt 24 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9P0W2
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human HMG20B
Linkage: Corresponding Antibody HPA069832.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/909