PrEST Antigen PKP3

Product Name: PrEST Antigen PKP3

Product Type: Chemical

CAS NO: 297-76-7Toll-like Receptor (TLR) inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000184363
Form: buffered aqueous solution
Immunogen sequence: FDDIDLPSAVKYLMASDPNLQVLGAAYIQHKCYSDAAAKKQARSLQAVPRLVKLFNHANQEVQRHATGAMRNLI
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9Y446
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human PKP3
Linkage: Corresponding Antibody HPA062937.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/1180

PrEST Antigen CYP11B1

Product Name: PrEST Antigen CYP11B1

Synonym: CPN1; CYP11B; FHI; P450C11

Product Type: Chemical

CAS NO: 52-21-1Thrombopoietin Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000160882
Form: buffered aqueous solution
Immunogen sequence: RFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPR
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P15538
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human CYP11B1
Linkage: Corresponding Antibody HPA056348.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/1171

PrEST Antigen BCAS2

Product Name: PrEST Antigen BCAS2

Synonym: DAM1; SPF27; Snt309

Product Type: Chemical

CAS NO: 28300-74-5SPHK inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000116752
Form: buffered aqueous solution
Immunogen sequence: MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLS
Mol wt: predicted mol wt 23 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: O75934
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human BCAS2
Linkage: Corresponding Antibody HPA067881.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/1163

PrEST Antigen MLN

Product Name: PrEST Antigen MLN

Product Type: Chemical

CAS NO: 28657-80-9Salt-inducible Kinase (SIK) inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000096395
Form: buffered aqueous solution
Immunogen sequence: AFVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEEN
Mol wt: predicted mol wt 23 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P12872
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human MLN
Linkage: Corresponding Antibody HPA069392.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/1155

PrEST Antigen SETD1A

Product Name: PrEST Antigen SETD1A

Synonym: KIAA0339; KMT2F; Set1

Product Type: Chemical

CAS NO: 298-57-7NOD-like Receptor (NLR) inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000099381
Form: buffered aqueous solution
Immunogen sequence: SQFRSSDANYPAYYESWNRYQRHTSYPPRRATREEPPGAPFAENTAERFPPSYTSYLPPEPSRPTDQDYRPPASEA
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: O15047
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human SETD1A
Linkage: Corresponding Antibody HPA058376.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/1145

PrEST Antigen ZNF616

Product Name: PrEST Antigen ZNF616

Synonym: MGC45556

Product Type: Chemical

CAS NO: 299-84-3MyD88 inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000204611
Form: buffered aqueous solution
Immunogen sequence: NQLTSNFESRLAELQKVQTEGRLYECNETEKTGNNGCLVSPHIREKTYVCN
Mol wt: predicted mol wt 23 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q08AN1
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human ZNF616
Linkage: Corresponding Antibody HPA071539.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/1138

PrEST Antigen ARSJ

Product Name: PrEST Antigen ARSJ

Synonym: FLJ23548

Product Type: Chemical

CAS NO: 1225037-39-7Interleukin Related inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000180801
Form: buffered aqueous solution
Immunogen sequence: TADPYERVDLSNRYPGIVKKLLRRLSQFNKTAVPVRYPPKDPRSNPRLNGGVWGPWYKEETKK
Mol wt: predicted mol wt 25 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q5FYB0
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human ARSJ
Linkage: Corresponding Antibody HPA036481.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/1130

PrEST Antigen IWS1

Product Name: PrEST Antigen IWS1

Synonym: DKFZp761G0123; FLJ10006; FLJ14655; FLJ32319

Product Type: Chemical

CAS NO: 4044-65-9FLAP inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000163166
Form: buffered aqueous solution
Immunogen sequence: NEELPKPRISDSESEDPPRNQASDSENEELPKPRVSDSESEGPQKGPASDSETEDASRHKQKPESDDDSDRENKGEDTEMQND
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q96ST2
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human IWS1
Linkage: Corresponding Antibody HPA061866.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/1121

PrEST Antigen AMER1

Product Name: PrEST Antigen AMER1

Synonym: FAM123B; FLJ39827; RP11-403E24.2; WTX

Product Type: Chemical

CAS NO: 1352792-74-5Complement System inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000184675
Form: buffered aqueous solution
Immunogen sequence: RDSPLSLYTEPPGAYDWPAWAPCPLPVGPGPAWISPNQLDRPSSQSPYRQATCCIPPMTMSISLSVPESRAPGESGPQLARPSHLHLP
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q5JTC6
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human AMER1
Linkage: Corresponding Antibody HPA065214.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/1114

PrEST Antigen COMMD4

Product Name: PrEST Antigen COMMD4

Synonym: FLJ20452

Product Type: Chemical

CAS NO: 302-22-7Vasopressin Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000140365
Form: buffered aqueous solution
Immunogen sequence: KILKLTADAKFESGDVKATVAVLSF
Mol wt: predicted mol wt 20 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9H0A8
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human COMMD4
Linkage: Corresponding Antibody HPA066957.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/1102