PrEST Antigen PHGR1

Product Name: PrEST Antigen PHGR1

Product Type: Chemical

CAS NO: 555-57-7Urotensin Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000233041
Form: buffered aqueous solution
Immunogen sequence: DPGKGHCHCGGHGHPPGHCGP
Mol wt: predicted mol wt 20 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: C9JFL3
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human PHGR1
Linkage: Corresponding Antibody HPA068787.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/1095

PrEST Antigen NUDT11

Product Name: PrEST Antigen NUDT11

Synonym: DIPP3a; hDIPP3alpha

Product Type: Chemical

CAS NO: 43218-56-0Somatostatin Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000196368
Form: buffered aqueous solution
Immunogen sequence: LQCHKPVHAEYLEKLKLGGSPTNGNS
Mol wt: predicted mol wt 20 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q96G61
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human NUDT11
Linkage: Corresponding Antibody HPA057684.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/1086

PrEST Antigen PHAX

Product Name: PrEST Antigen PHAX

Synonym: FLJ13193; RNUXA

Product Type: Chemical

CAS NO: 51-45-6RGS Protein inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000164902
Form: buffered aqueous solution
Immunogen sequence: ESQEHTKDLDKELDEYMHGGKKMGSKEEENGQGHLKRKRPVKDRLGNRPEMNYKGRYEITAEDSQEKVADEISFRLQEPKKDLI
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9H814
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human PHAX
Linkage: Corresponding Antibody HPA070326.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/1075

PrEST Antigen PDE2A

Product Name: PrEST Antigen PDE2A

Product Type: Chemical

CAS NO: 52-51-7Protease-Activated Receptor (PAR) inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000186642
Form: buffered aqueous solution
Immunogen sequence: EHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPA
Mol wt: predicted mol wt 29 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: O00408
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human PDE2A
Linkage: Corresponding Antibody HPA031192.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/1067

PrEST Antigen PER2

Product Name: PrEST Antigen PER2

Synonym: KIAA0347

Product Type: Chemical

CAS NO: 940-69-2P2Y Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000132326
Form: buffered aqueous solution
Immunogen sequence: LSIFQSHCHYYLQERSKGQPSERTAPGLRNTSGIDSPWKKTGKNRKLKSKRVKPRDSSESTGSGGPVSARPPLVGLNATAWSPSDTSQSSCPA
Mol wt: predicted mol wt 28 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: O15055
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human PER2
Linkage: Corresponding Antibody HPA060510.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/1061

PrEST Antigen IRF1

Product Name: PrEST Antigen IRF1

Synonym: MAR

Product Type: Chemical

CAS NO: 33089-61-1Orexin Receptor (OX Receptor) inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000125347
Form: buffered aqueous solution
Immunogen sequence: SAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTP
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P10914
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human IRF1
Linkage: Corresponding Antibody HPA063131.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/1052

PrEST Antigen TM6SF2

Product Name: PrEST Antigen TM6SF2

Synonym: Lpr4

Product Type: Chemical

CAS NO: 32795-44-1Neurotensin Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000213996
Form: buffered aqueous solution
Immunogen sequence: PTDACFVYIYQYEPYLRDPVAYPKVQ
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9BZW4
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human TM6SF2
Linkage: Corresponding Antibody HPA066026.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/1044

PrEST Antigen FOXB2

Product Name: PrEST Antigen FOXB2

Synonym: bA159H20.4

Product Type: Chemical

CAS NO: 6199-67-3Neurokinin Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000204612
Form: buffered aqueous solution
Immunogen sequence: IGRDYKGVLQAGGLPLASVMHHLGYPVPGQLGNVVSSVWPHVGVMD
Mol wt: predicted mol wt 22 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q5VYV0
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human FOXB2
Linkage: Corresponding Antibody HPA067947.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/1038

PrEST Antigen DHRS2

Product Name: PrEST Antigen DHRS2

Synonym: HEP27; SDR25C1

Product Type: Chemical

CAS NO: 497833-27-9Motilin Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000100867
Form: buffered aqueous solution
Immunogen sequence: EDREQLVAKALEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQL
Mol wt: predicted mol wt 24 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q13268
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human DHRS2
Linkage: Corresponding Antibody HPA069551.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/1029

PrEST Antigen CSTB

Product Name: PrEST Antigen CSTB

Synonym: CST6; EPM1; PME; STFB

Product Type: Chemical

CAS NO: 199657-29-9mGluR inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000160213
Form: buffered aqueous solution
Immunogen sequence: MMCGAPSATQPATAETQHIADQ
Mol wt: predicted mol wt 20 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P04080
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human CSTB
Linkage: Corresponding Antibody HPA058557.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/1021