PrEST Antigen NIPAL2

Product Name: PrEST Antigen NIPAL2

Synonym: FLJ13955; NPAL2

Product Type: Chemical

CAS NO: 137330-13-3Melatonin Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000104361
Form: buffered aqueous solution
Immunogen sequence: FLVTRNREKEHLQQSYIDFGNIPDTTPERKAWRETN
Mol wt: predicted mol wt 22 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9H841
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human NIPAL2
Linkage: Corresponding Antibody HPA071759.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/1014

PrEST Antigen GPX8

Product Name: PrEST Antigen GPX8

Synonym: EPLA847; UNQ847

Product Type: Chemical

CAS NO: 28598-08-5LPL Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000164294
Form: buffered aqueous solution
Immunogen sequence: WKYLVNPEGQVVKFWRPEEPIEVIRPDIAALVRQVII
Mol wt: predicted mol wt 22 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q8TED1
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human GPX8
Linkage: Corresponding Antibody HPA036720.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/1007

PrEST Antigen BTLA

Product Name: PrEST Antigen BTLA

Synonym: BTLA1; CD272

Product Type: Chemical

CAS NO: 2901-75-9Leukotriene Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000186265
Form: buffered aqueous solution
Immunogen sequence: ETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGLNSRLARNVKEAPTE
Mol wt: predicted mol wt 24 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q7Z6A9
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human BTLA
Linkage: Corresponding Antibody HPA062029.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/3/1001

PrEST Antigen ACY3

Product Name: PrEST Antigen ACY3

Synonym: ACY-3; HCBP1; MGC9740

Product Type: Chemical

CAS NO: 304-84-7Histamine Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000132744
Form: buffered aqueous solution
Immunogen sequence: MCSLPVPQEPLRRVAVTGGTHGNEMSGVYLARHWLHAPAELQRASFSAVPVLANPAATSGCRRYVDHDLNRTFTSSFLNSR
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q96HD9
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human ACY3
Linkage: Corresponding Antibody HPA048187.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/2/888

PrEST Antigen CLPB

Product Name: PrEST Antigen CLPB

Synonym: FLJ13152; HSP78; SKD3

Product Type: Chemical

CAS NO: 306-20-7Guanylate Cyclase inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000162129
Form: buffered aqueous solution
Immunogen sequence: RRKENGWYDEEHPLVFLFLGSSGIGKTELAKQTAKYMHKDAKKGFIRLDMSEFQERHEVAKFIGSPPGYVGHEEGGQLTKKLKQCPNAVVLF
Mol wt: predicted mol wt 28 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9H078
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human CLPB
Linkage: Corresponding Antibody HPA064571.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/2/880

PrEST Antigen CNKSR3

Product Name: PrEST Antigen CNKSR3

Synonym: FLJ31349; MAGI1

Product Type: Chemical

CAS NO: 313-06-4GPR55 inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000153721
Form: buffered aqueous solution
Immunogen sequence: FLDQESRRRRFTIADSDQLPGYSVETNILPTKMREKTPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRKGEDALCRYFSNERIP
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human CNKSR3
Linkage: Corresponding Antibody HPA049651.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/2/874

PrEST Antigen SFPQ

Product Name: PrEST Antigen SFPQ

Synonym: PPP1R140; PSF

Product Type: Chemical

CAS NO: 314-13-6GPR139 inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000116560
Form: buffered aqueous solution
Immunogen sequence: EEEMMIRQREMEEQMRRQREESYSRMGYMDPRERDMRMGGGGAMNMGDPYGSGGQKFPPLGGGGGI
Mol wt: predicted mol wt 25 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P23246
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human SFPQ
Linkage: Corresponding Antibody HPA054689.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/2/867

PrEST Antigen IPO11

Product Name: PrEST Antigen IPO11

Synonym: RanBP11

Product Type: Chemical

CAS NO: 463130GPR120 inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000086200
Form: buffered aqueous solution
Immunogen sequence: QLLGNMIEMWVDRMDNITQPERRKLSALALLSLLPSDNSVIQDKFCGIINISVEGLHDVMTEDPETGTYKDCMLMSHLEEPKVTEDEEPPTEQD
Mol wt: predicted mol wt 28 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9UI26
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human IPO11
Linkage: Corresponding Antibody HPA067097.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/2/858

PrEST Antigen FXYD2

Product Name: PrEST Antigen FXYD2

Product Type: Chemical

CAS NO: 31842-01-0GPR119 inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000137731
Form: buffered aqueous solution
Immunogen sequence: SRRFRCGGNKKRRQINEDEP
Mol wt: predicted mol wt 20 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P54710
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human FXYD2
Linkage: Corresponding Antibody HPA068838.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/2/849

PrEST Antigen CD84

Product Name: PrEST Antigen CD84

Synonym: SLAMF5; hCD84; mCD84

Product Type: Chemical

CAS NO: 319-89-1GPR109A inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000066294
Form: buffered aqueous solution
Immunogen sequence: RRQGRIFPEDAASKKTIYTYIMASRNTQPAESRIYDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTS
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9UIB8
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human CD84
Linkage: Corresponding Antibody HPA070502.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/2/840