C14-demethylase

Product Name: PrEST Antigen TRIM72

Synonym: MG53

Product Type: Chemical

CAS NO: 84272-85-5Bombesin Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000177238
Form: buffered aqueous solution
Immunogen sequence: LEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLVGPE
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q6ZMU5
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human TRIM72
Linkage: Corresponding Antibody HPA054909.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/2/741

Product Name: PrEST Antigen NIPA2

Product Type: Chemical

CAS NO: 70831-56-0Adrenergic Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000140157
Form: buffered aqueous solution
Immunogen sequence: KEEEIETLNEMSHKLGDPGFVVF
Mol wt: predicted mol wt 20 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q8N8Q9
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human NIPA2
Linkage: Corresponding Antibody HPA067160.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/2/736

Product Name: PrEST Antigen UBN1

Product Type: Chemical

CAS NO: 74285-86-2Adiponectin Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000118900
Form: buffered aqueous solution
Immunogen sequence: AKKKVMAPSKIKVKESSTKPDKKVSVPSGQIGGPIALPSDHQTGGLSIGASSRELPSQASGGLANPPPVNLEDSLDEDLIRNPASSVEA
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9NPG3
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human UBN1
Linkage: Corresponding Antibody HPA069045.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/2/730

Product Name: PrEST Antigen C10orf128

Synonym: Em:AC084727.5

Product Type: Chemical

CAS NO: 1077-28-7Adenosine Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000204161
Form: buffered aqueous solution
Immunogen sequence: KICMIRRHLFDDDSSDLKSTPGGLSDTIPLKKRAPRAHVLRD
Mol wt: predicted mol wt 22 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q5T292
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human C10orf128
Linkage: Corresponding Antibody HPA058166.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/2/723

Product Name: PrEST Antigen SPECC1L

Synonym: CYTSA; KIAA0376

Product Type: Chemical

CAS NO: 20575-57-95-HT Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000100014
Form: buffered aqueous solution
Immunogen sequence: QRHSISGPISTSKPLTALSDKRPNYGEIPVQEHLLRTSSASRPASLPRVPAMESAKT
Mol wt: predicted mol wt 24 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q69YQ0
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human SPECC1L
Linkage: Corresponding Antibody HPA070614.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/2/716

Product Name: PrEST Antigen C3orf38

Synonym: MGC26717

Product Type: Chemical

CAS NO: 41372-20-7PKC inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000179021
Form: buffered aqueous solution
Immunogen sequence: FGLIRCPFVENTWKIKFINLKIMGESSLAPGTLPKPSVKFEQSDLEAFYNVITVCGTNEVRHNVKQASDSGTG
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q5JPI3
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human C3orf38
Linkage: Corresponding Antibody HPA034736.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/2/711

Product Name: PrEST Antigen EGFL8

Synonym: C6orf8; NG3

Product Type: Chemical

CAS NO: 857036-77-2MicroRNA inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000241404
Form: buffered aqueous solution
Immunogen sequence: FNTAGSFTCGCPHDLVLGVDGRTCMEGSPEPPTSASILSVAVREAEKDERALKQEIHELRG
Mol wt: predicted mol wt 24 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q99944
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human EGFL8
Linkage: Corresponding Antibody HPA061173.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/2/704

Product Name: PrEST Antigen SLC6A19

Product Type: Chemical

CAS NO: 913064-47-8JAK inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000174358
Form: buffered aqueous solution
Immunogen sequence: MVRLVLPNPGLDARIPSLAELETIEQEEASSRPKWDNK
Mol wt: predicted mol wt 22 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q695T7
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human SLC6A19
Linkage: Corresponding Antibody HPA043207.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/2/695

Product Name: PrEST Antigen UBE2Q1

Synonym: NICE-5; PRO3094; UBE2Q

Product Type: Chemical

CAS NO: 1428569-85-0Histone Demethylase inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000160714
Form: buffered aqueous solution
Immunogen sequence: PCLRRELKLLESIFHRGHERFRIASACLDELSCEFLLAG
Mol wt: predicted mol wt 22 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q7Z7E8
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human UBE2Q1
Linkage: Corresponding Antibody HPA063368.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/2/688

Product Name: PrEST Antigen HHIPL1

Synonym: KIAA1822

Product Type: Chemical

CAS NO: 61036-62-2Epigenetic Reader Domain inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000182218
Form: buffered aqueous solution
Immunogen sequence: GRLMSLQENPGTGQWQYSEICMGHGQTCEFPGLINNYYPYIISFG
Mol wt: predicted mol wt 23 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q96JK4
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human HHIPL1
Linkage: Corresponding Antibody HPA052767.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/2/681