C14-demethylase

Product Name: PrEST Antigen JAK3

Synonym: JAK-3; JAK3_HUMAN; JAKL; L-JAK; LJAK

Product Type: Chemical

CAS NO: 5466-77-3Arenavirus inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000105639
Form: buffered aqueous solution
Immunogen sequence: ETFHVGLPGALGGHDGLGLLRVAGDGGIAWTQGEQEVLQPFCDFPEIVDISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGL
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P52333
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human JAK3
Linkage: Corresponding Antibody HPA070314.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/1/257

Product Name: PrEST Antigen SLC52A2

Synonym: D15Ertd747e; FLJ11856; GPCR41; GPR172A; PAR1; RFVT2; hRFT3

Product Type: Chemical

CAS NO: 56238-63-2Anti-infection inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000185803
Form: buffered aqueous solution
Immunogen sequence: ELGSGLQVGAPGAEEEVEESSPL
Mol wt: predicted mol wt 20 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9HAB3
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human SLC52A2
Linkage: Corresponding Antibody HPA063036.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/1/247

Product Name: PrEST Antigen SLC7A8

Synonym: LAT2; LPI-PC1

Product Type: Chemical

CAS NO: 57-08-9JNK inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000092068
Form: buffered aqueous solution
Immunogen sequence: MEEGARHRNNTEKKHPGGGESDASPEAGSGGGGVALKKEI
Mol wt: predicted mol wt 22 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9UHI5
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human SLC7A8
Linkage: Corresponding Antibody HPA051950.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/1/238

Product Name: PrEST Antigen CSNK1G2

Synonym: CK1g2

Product Type: Chemical

CAS NO: 577-11-7ERK inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000133275
Form: buffered aqueous solution
Immunogen sequence: IGTVHTDLPSQPQLRDKTQPHSKNQALNSTNG
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P78368
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human CSNK1G2
Linkage: Corresponding Antibody HPA056572.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/1/232

Product Name: PrEST Antigen UBAP1L

Product Type: Chemical

CAS NO: 52-49-3MAPK_ERK Pathway inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000246922
Form: buffered aqueous solution
Immunogen sequence: STAGAIPPLRSHKPTVASLSPYTCLPPLGGAPQPLNPHKSHPDTAADLLSALSQEEQDLIGPVVALGYPLRRAIIALQKTGRQ
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: F5GYI3
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human UBAP1L
Linkage: Corresponding Antibody HPA067923.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/1/226

Product Name: PrEST Antigen MAPT

Synonym: DDPAC; FLJ31424; FTDP-17; MAPTL; MGC138549; MSTD; MTBT1; MTBT2; PPND; PPP1R103; tau

Product Type: Chemical

CAS NO: 59729-32-7STAT inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000186868
Form: buffered aqueous solution
Immunogen sequence: PLEFTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPAAAPRGKPVSRVPQLKARMVS
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P10636
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human MAPT
Linkage: Corresponding Antibody HPA069524.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/1/218

Product Name: PrEST Antigen RFC4

Synonym: A1; RFC37

Product Type: Chemical

CAS NO: 6004-24-6Pim inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000163918
Form: buffered aqueous solution
Immunogen sequence: VVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLSQN
Mol wt: predicted mol wt 23 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P35249
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human RFC4
Linkage: Corresponding Antibody HPA058507.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/1/211

Product Name: PrEST Antigen MBLAC1

Synonym: MGC49416

Product Type: Chemical

CAS NO: 6080-58-6EGFR inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000214309
Form: buffered aqueous solution
Immunogen sequence: HDFCLPGGRYLPHGLGEGQPLRLGPGLEVWATPGHGGQRDVSVVVAGTALGTVVVAGDVFERDGDE
Mol wt: predicted mol wt 24 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: A4D2B0
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human MBLAC1
Linkage: Corresponding Antibody HPA071574.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/1/204

Product Name: PrEST Antigen INPP1

Product Type: Chemical

CAS NO: 70-26-8Toll-like Receptor (TLR) inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000151689
Form: buffered aqueous solution
Immunogen sequence: TSEKETIKAALSRVCGDRIFGAAGAGYKSLCVVQGLVDIYIFSEDTTFKWDSCAAHAILRAMGGGIVDLKECLERNPETGLDLPQLVY
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P49441
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human INPP1
Linkage: Corresponding Antibody HPA036699.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/1/196

Product Name: PrEST Antigen ACSS3

Synonym: FLJ21963

Product Type: Chemical

CAS NO: 7280-37-7Thrombopoietin Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000111058
Form: buffered aqueous solution
Immunogen sequence: ASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYIL
Mol wt: predicted mol wt 28 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human ACSS3
Linkage: Corresponding Antibody HPA047956.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/303/1/188