PrEST Antigen PRDM13

Product Name: PrEST Antigen PRDM13

Product Type: Chemical

CAS NO: 7179-49-9Orexin Receptor (OX Receptor) inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000112238
Form: buffered aqueous solution
Immunogen sequence: LPGARYAQLPPAPGLPLERCALPPLDPGGLKAYPGGECSHLPAVMPAFTVYNGELLYGSPATTAYYPLKL
Mol wt: predicted mol wt 25 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9H4Q3
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human PRDM13
Linkage: Corresponding Antibody HPA070592.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/3/940

PrEST Antigen TAS1R1

Product Name: PrEST Antigen TAS1R1

Synonym: GPR70; T1R1; TR1

Product Type: Chemical

CAS NO: 67-48-1Opioid Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000173662
Form: buffered aqueous solution
Immunogen sequence: LSRHITGVPGIQRIGMVLGVAIQKRAVPGLKAFEEAYARADKEAPRPCHKGSWCSSNQLCRECQAFMAHTMPKLKAFSMSSAYNAYRAVYAVAH
Mol wt: predicted mol wt 28 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q7RTX1
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human TAS1R1
Linkage: Corresponding Antibody HPA034579.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/3/935

PrEST Antigen KRT6A

Product Name: PrEST Antigen KRT6A

Synonym: KRT6E

Product Type: Chemical

CAS NO: 66215-27-8Neurotensin Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000205420
Form: buffered aqueous solution
Immunogen sequence: SGRAIGGGLSSVGGGSSTIKYTTTSSSSRKSYKH
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P02538
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human KRT6A
Linkage: Corresponding Antibody HPA061168.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/3/924

PrEST Antigen BMP4

Product Name: PrEST Antigen BMP4

Synonym: BMP2B

Product Type: Chemical

CAS NO: 65710-07-8Neuropeptide Y Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000125378
Form: buffered aqueous solution
Immunogen sequence: KVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPELP
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P12644
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human BMP4
Linkage: Corresponding Antibody HPA066235.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/3/918

PrEST Antigen GPR37

Product Name: PrEST Antigen GPR37

Synonym: EDNRBL; PAELR; hET(B)R-LP

Product Type: Chemical

CAS NO: 64-72-2Neurokinin Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000170775
Form: buffered aqueous solution
Immunogen sequence: RAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYG
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: O15354
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human GPR37
Linkage: Corresponding Antibody HPA068009.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/3/908

PrEST Antigen FOXL2

Product Name: PrEST Antigen FOXL2

Synonym: BPES; BPES1

Product Type: Chemical

CAS NO: 1556278Motilin Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000183770
Form: buffered aqueous solution
Immunogen sequence: MMASYPEPEDAAGALLAPETGRTVKEPEGPPPSPGKGG
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P58012
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human FOXL2
Linkage: Corresponding Antibody HPA069613.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/3/898

PrEST Antigen HES7

Product Name: PrEST Antigen HES7

Synonym: bHLHb37

Product Type: Chemical

CAS NO: 6153-33-9mGluR inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000179111
Form: buffered aqueous solution
Immunogen sequence: PPPPHSQDGAPKAPLPPPPAFWRPWP
Mol wt: predicted mol wt 20 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9BYE0
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human HES7
Linkage: Corresponding Antibody HPA072105.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/3/889

PrEST Antigen PSTK

Product Name: PrEST Antigen PSTK

Synonym: C10orf89; MGC35392

Product Type: Chemical

CAS NO: 58-71-9Melatonin Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000179988
Form: buffered aqueous solution
Immunogen sequence: KTAENIRGTGSDGPRKRGLCVLCGLPAAGKSTFARALAHRLQQEQGWAIGVVAYDDVMPDAFLAGARARPAPSQWKLLRQE
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q8IV42
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human PSTK
Linkage: Corresponding Antibody HPA037780.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/3/881

PrEST Antigen PAGE3

Product Name: PrEST Antigen PAGE3

Synonym: CT16.6; GAGED1; PAGE-3

Product Type: Chemical

CAS NO: 553-12-8mAChR inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000204279
Form: buffered aqueous solution
Immunogen sequence: GERGDGPNVKGEFLPNLEPVKIPEAGEGQPSV
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q5JUK9
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human PAGE3
Linkage: Corresponding Antibody HPA062248.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/3/871

PrEST Antigen TUB

Product Name: PrEST Antigen TUB

Synonym: rd5

Product Type: Chemical

CAS NO: 53797-35-6LPL Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000166402
Form: buffered aqueous solution
Immunogen sequence: LPSFWVSFFAETGILFPGGTPWPMGSQHSKQHRKPGPLKRGHRRDRRTTRRKYWKEGREI
Mol wt: predicted mol wt 25 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P50607
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human TUB
Linkage: Corresponding Antibody HPA049019.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/3/861