PrEST Antigen SAT2

Product Name: PrEST Antigen SAT2

Synonym: SSAT2

Product Type: Chemical

CAS NO: 20724-73-6GNRH Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000141504
Form: buffered aqueous solution
Immunogen sequence: LRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLV
Mol wt: predicted mol wt 22 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q96F10
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human SAT2
Linkage: Corresponding Antibody HPA057096.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/3/1246

PrEST Antigen CYFIP1

Product Name: PrEST Antigen CYFIP1

Synonym: PIR121

Product Type: Chemical

CAS NO: 186139-09-3Glucocorticoid Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000273749
Form: buffered aqueous solution
Immunogen sequence: TLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHN
Mol wt: predicted mol wt 24 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q7L576
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human CYFIP1
Linkage: Corresponding Antibody HPA068106.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/3/1238

PrEST Antigen NFAT5

Product Name: PrEST Antigen NFAT5

Synonym: KIAA0827; NF-AT5; NFATL1; NFATZ; OREBP; TONEBP

Product Type: Chemical

CAS NO: 131179-95-8Glucagon Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000102908
Form: buffered aqueous solution
Immunogen sequence: SMWMEDSPSNFSNMSTSSYNDNTEVPRKSRKRNPKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQLTTDNKGNSKAGNGT
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: O94916
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human NFAT5
Linkage: Corresponding Antibody HPA069711.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/3/1228

PrEST Antigen CLTC

Product Name: PrEST Antigen CLTC

Synonym: CLTCL2; Hc

Product Type: Chemical

CAS NO: 170787-99-2GHSR inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000141367
Form: buffered aqueous solution
Immunogen sequence: ESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQ
Mol wt: predicted mol wt 22 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q00610
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human CLTC
Linkage: Corresponding Antibody HPA059143.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/3/1220

PrEST Antigen HPSE

Product Name: PrEST Antigen HPSE

Synonym: HPA; HPSE1; HSE1

Product Type: Chemical

CAS NO: 1798871-30-3EBI2_GPR183 inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000173083
Form: buffered aqueous solution
Immunogen sequence: QDICKYGSIPPDVEEKLRLEWPYQEQLLLREHYQKKFKNSTYSRSSVDVLYTFANCSGLDLIFGLNALLRTADLQWNSSNAQLLLDYCSSK
Mol wt: predicted mol wt 28 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9Y251
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human HPSE
Linkage: Corresponding Antibody HPA055344.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/3/1212

PrEST Antigen KLHL10

Product Name: PrEST Antigen KLHL10

Synonym: FLJ32662

Product Type: Chemical

CAS NO: 333-41-5Dopamine Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000161594
Form: buffered aqueous solution
Immunogen sequence: AVGGFDGANRLRSAEAYSPVANTWRTIPTMFNPRSNFGIEVVDDLLFVVGGFNGFTTTFNVECYDEKTDEWYDAHDMSIYRSALSCCVVPGLA
Mol wt: predicted mol wt 28 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q6JEL2
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human KLHL10
Linkage: Corresponding Antibody HPA067538.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/3/1201

PrEST Antigen TOE1

Product Name: PrEST Antigen TOE1

Product Type: Chemical

CAS NO: 4884-68-8CRTH2 (GPR44) inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000132773
Form: buffered aqueous solution
Immunogen sequence: LHRAGFDAFMTGYVMAYVEVSQGPQPCSSGPWLPECHNKVYLSGKAVPLTVAKSQFSRSSKAHNQKMKLTWGS
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q96GM8
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human TOE1
Linkage: Corresponding Antibody HPA069119.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/3/1193

PrEST Antigen TYRO3

Product Name: PrEST Antigen TYRO3

Synonym: Brt; Dtk; RSE; Sky; Tif

Product Type: Chemical

CAS NO: 4940-39-0Cholecystokinin Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000092445
Form: buffered aqueous solution
Immunogen sequence: RPSFTCLRMELENILGQLSVLSASQDPLYINIERAEEPTAGGSLELPGRDQPYSGAGDGSGMGAVGGTPSDCRY
Mol wt: predicted mol wt 25 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q06418
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human TYRO3
Linkage: Corresponding Antibody HPA071245.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/3/1184

PrEST Antigen NDUFAF3

Product Name: PrEST Antigen NDUFAF3

Synonym: 2P1; C3orf60; DKFZP564J0123; E3-3; MGC10527

Product Type: Chemical

CAS NO: 50-03-3CGRP Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000178057
Form: buffered aqueous solution
Immunogen sequence: ADDELYQRTRISLLQREAAQAMYIDSYNSRGFMINGNRVLGPCALLPHSVVQWNVGSHQDITEDSF
Mol wt: predicted mol wt 25 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9BU61
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human NDUFAF3
Linkage: Corresponding Antibody HPA035376.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/3/1176

PrEST Antigen CCDC122

Product Name: PrEST Antigen CCDC122

Synonym: FLJ31846

Product Type: Chemical

CAS NO: 502-55-6CaSR inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000151773
Form: buffered aqueous solution
Immunogen sequence: NTKLHCDSLETQIKSLHSENVKLKFDIETAQEDFEEHMIKYNAYYAKIKAHK
Mol wt: predicted mol wt 24 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q5T0U0
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human CCDC122
Linkage: Corresponding Antibody HPA061456.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/3/1168