C14-demethylase

Product Name: PrEST Antigen VARS2

Synonym: DKFZP434L1435; G7a; KIAA1885; VARS2L; VARSL

Product Type: Chemical

CAS NO: 312951-85-2HDAC inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000137411
Form: buffered aqueous solution
Immunogen sequence: NALRFILNALGEKFVPQPAEELSPSSPMDAWILSRLALAAQECERGFLTRELSLVTHALHHFWLHNLCDVYLE
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q5ST30
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human VARS2
Linkage: Corresponding Antibody HPA070267.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/2/687

Product Name: PrEST Antigen STEAP1

Synonym: PRSS24; STEAP

Product Type: Chemical

CAS NO: 89705-21-5G-quadruplex inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000164647
Form: buffered aqueous solution
Immunogen sequence: CLRKKILKIRHGWEDVTKINKTEICSQL
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9UHE8
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human STEAP1
Linkage: Corresponding Antibody HPA030985.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/2/681

Product Name: PrEST Antigen SCLY

Synonym: SCL

Product Type: Chemical

CAS NO: 173952-44-8Eukaryotic Initiation Factor (eIF) inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000132330
Form: buffered aqueous solution
Immunogen sequence: LYPMLFGGGQERNFRPGTENTPMIAGLGKAAELVTQNCEAYEAHMRDVRDYLEERLEAEFGQKRIHLNS
Mol wt: predicted mol wt 25 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human SCLY
Linkage: Corresponding Antibody HPA055760.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/2/672

Product Name: PrEST Antigen EWSR1

Synonym: EWS

Product Type: Chemical

CAS NO: 142326-59-8DNA_RNA Synthesis inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000182944
Form: buffered aqueous solution
Immunogen sequence: GDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPG
Mol wt: predicted mol wt 24 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human EWSR1
Linkage: Corresponding Antibody HPA062953.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/2/666

Product Name: PrEST Antigen ARHGAP35

Synonym: GRF-1; GRLF1; KIAA1722; P190A; p190ARhoGAP; p190RhoGAP

Product Type: Chemical

CAS NO: 1440209-96-0DNA Stain inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000160007
Form: buffered aqueous solution
Immunogen sequence: VNVDLAFSTLVQLIDKSRGKTKIIPYFEALKQQSQQIATAKDKYEWLVSRIVKNHNENWLSVSRKMQASPEYQDYVYLEGTQKAKKLF
Mol wt: predicted mol wt 28 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human ARHGAP35
Linkage: Corresponding Antibody HPA056470.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/2/659

Product Name: PrEST Antigen MYH14

Synonym: DFNA4; FLJ13881; KIAA2034; MHC16; MYH17

Product Type: Chemical

CAS NO: 1346242-81-6DNA Alkylator_Crosslinker inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000105357
Form: buffered aqueous solution
Immunogen sequence: FTTRTVRQVFRLEEGVASDEEAEEAQPGSGPSPEPEGSPP
Mol wt: predicted mol wt 22 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q7Z406
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human MYH14
Linkage: Corresponding Antibody HPA067889.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/2/651

Product Name: PrEST Antigen TMEM135

Synonym: FLJ22104

Product Type: Chemical

CAS NO: 854601-70-0Deubiquitinase inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000166575
Form: buffered aqueous solution
Immunogen sequence: SALRFIVGKEEIPTHSFSPEAAYAKVEQKREQHEEKPRRMNMIGLVRKFVDSICKHGPRHRCCKHYEDNC
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q86UB9
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human TMEM135
Linkage: Corresponding Antibody HPA069473.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/2/645

Product Name: PrEST Antigen FXYD4

Synonym: CHIF

Product Type: Chemical

CAS NO: 175131-60-9Checkpoint Kinase (Chk) inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000150201
Form: buffered aqueous solution
Immunogen sequence: ANDPFANKDDPFYYDWKNLQL
Mol wt: predicted mol wt 20 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P59646
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human FXYD4
Linkage: Corresponding Antibody HPA058421.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/2/636

Product Name: PrEST Antigen NOXO1

Synonym: P41NOXA; P41NOXB; P41NOXC; SH3PXD5; SNX28

Product Type: Chemical

CAS NO: 674-38-4CDK inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000196408
Form: buffered aqueous solution
Immunogen sequence: LLETYSRRLLATAERVARSPTITGFFAPQPLDLE
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q8NFA2
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human NOXO1
Linkage: Corresponding Antibody HPA071540.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/2/627

Product Name: PrEST Antigen SCLT1

Synonym: FLJ30655; hCAP-1A

Product Type: Chemical

CAS NO: 537-12-2Aurora Kinase inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000151466
Form: buffered aqueous solution
Immunogen sequence: STMEHEFSIKERGFEVQLREMEDSNRNSIVELRHLLATQQKAANRWKEETKKLTESAEIRINNLKSELSRQKLHTQELLSQLEMANEK
Mol wt: predicted mol wt 28 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q96NL6
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human SCLT1
Linkage: Corresponding Antibody HPA036560.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/2/619