C14-demethylase

Product Name: PrEST Antigen ADH5

Synonym: ADH-3; ADHX; FDH

Product Type: Chemical

CAS NO: 53716-49-7ATM_ATR inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000197894
Form: buffered aqueous solution
Immunogen sequence: GGWKSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSI
Mol wt: predicted mol wt 23 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P11766
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human ADH5
Linkage: Corresponding Antibody HPA061919.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/2/612

Product Name: PrEST Antigen LY6D

Synonym: E48

Product Type: Chemical

CAS NO: 541-46-8APC inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000167656
Form: buffered aqueous solution
Immunogen sequence: ESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAP
Mol wt: predicted mol wt 22 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q14210
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human LY6D
Linkage: Corresponding Antibody HPA064317.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/2/606

Product Name: PrEST Antigen UBE2M

Synonym: UBC12; hUbc12

Product Type: Chemical

CAS NO: 54-95-5Antifolate inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000130725
Form: buffered aqueous solution
Immunogen sequence: LEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P61081
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human UBE2M
Linkage: Corresponding Antibody HPA054551.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/2/601

Product Name: PrEST Antigen TSPO2

Synonym: BZRPL1; dJ34B21.2

Product Type: Chemical

CAS NO: 89786-04-9Cell Cycle_DNA Damage inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000112212
Form: buffered aqueous solution
Immunogen sequence: TRDHMSGWCEGPRMLSWCPFYKV
Mol wt: predicted mol wt 20 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q5TGU0
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human TSPO2
Linkage: Corresponding Antibody HPA066996.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/2/594

Product Name: PrEST Antigen C12orf77

Product Type: Chemical

CAS NO: 59703-84-3ULK inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000226397
Form: buffered aqueous solution
Immunogen sequence: GSKQGNVQTLDSIRWMPATPVPAPECHQKYAISTETAFPTLSTFMNTEKSVKGSNADFTKRNPRWRFL
Mol wt: predicted mol wt 25 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: C9JDV5
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human C12orf77
Linkage: Corresponding Antibody HPA068791.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/2/584

Product Name: PrEST Antigen HOXD4

Synonym: HOX4; HOX4B

Product Type: Chemical

CAS NO: 546-88-3LRRK2 inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000170166
Form: buffered aqueous solution
Immunogen sequence: ARAYSQSDPKQPPSGTALKQPAVVYPWMKKV
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P09016
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human HOXD4
Linkage: Corresponding Antibody HPA070349.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/2/577

Product Name: PrEST Antigen ECI2

Synonym: ACBD2; DRS1; HCA88; PECI

Product Type: Chemical

CAS NO: 543-82-8Autophagy inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000198721
Form: buffered aqueous solution
Immunogen sequence: DRATFHTPFSHLGQSPEGCSSYTFPKIMSPAKATEMLIFGKKLTAGEACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNALRISKEVIRKREREKLHAVNAEECNVLQGRWLSDECTNAVVNF
Mol wt: predicted mol wt 31 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: O75521
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human ECI2
Linkage: Corresponding Antibody HPA031626.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/2/568

Product Name: PrEST Antigen LPA

Synonym: LP

Product Type: Chemical

CAS NO: 54-36-4Autophagy inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000198670
Form: buffered aqueous solution
Immunogen sequence: WEYCNLTQCSETESGVLETPTVVPVPSMEAHSEAAPTEQTPVVRQCYHG
Mol wt: predicted mol wt 23 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P08519
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human LPA
Linkage: Corresponding Antibody HPA060604.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/2/560

Product Name: PrEST Antigen PROZ

Synonym: PZ

Product Type: Chemical

CAS NO: 54-30-8Thymidylate Synthase inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000126231
Form: buffered aqueous solution
Immunogen sequence: TPEKDFAEHLLIPRTRGLLSGWARNGTDLGNSLTTRPVTLVEGEECGQVLNVTVTTRTYCERSSVAAMHWMDGSVVTREHRGSWFLTGVLGSQPVGGQAHMVLVTKVSRYS
Mol wt: predicted mol wt 30 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P22891
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human PROZ
Linkage: Corresponding Antibody HPA052006.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/2/551

Product Name: PrEST Antigen ADRA2B

Synonym: ADRA2L1; ADRA2RL1; ADRARL1

Product Type: Chemical

CAS NO: 62893-20-3Survivin inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000274286
Form: buffered aqueous solution
Immunogen sequence: IAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASVASAREVN
Mol wt: predicted mol wt 23 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human ADRA2B
Linkage: Corresponding Antibody HPA066029.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/2/545