C14-demethylase

Product Name: PrEST Antigen TRIM60

Synonym: FLJ35882; RNF129; RNF33

Product Type: Chemical

CAS NO: 112093-28-4Anti-cancer_Compound_Library inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000176979
Form: buffered aqueous solution
Immunogen sequence: VGNKPKWILGVCQDCLLRNWQDQPSVLGGFWAIGRYMKSGYVASGPKTTQLLPVVKPSK
Mol wt: predicted mol wt 24 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q495X7
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human TRIM60
Linkage: Corresponding Antibody HPA061496.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/1/163

Product Name: PrEST Antigen CLDN17

Synonym: MGC126552; MGC126554

Product Type: Chemical

CAS NO: 448947-81-7screening-libraries inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000156282
Form: buffered aqueous solution
Immunogen sequence: CNRKKQGYRYPVPGYRVPHTDKRRNTTMLSKTSTSYV
Mol wt: predicted mol wt 22 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P56750
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human CLDN17
Linkage: Corresponding Antibody HPA045903.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/1/153

Product Name: PrEST Antigen LMNB1

Product Type: Chemical

CAS NO: 53-06-5Others inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000113368
Form: buffered aqueous solution
Immunogen sequence: KLQIELGKCKAEHDQLLLNYAKKESDLNGAQIKLREYEAALNSKDAALATALGDKKSLEGDLEDLKDQIAQL
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P20700
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human LMNB1
Linkage: Corresponding Antibody HPA053579.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/1/145

Product Name: PrEST Antigen MZT1

Synonym: C13orf37; FLJ21869; LOC440145; MGC150539; MOZART1; RP11-11C5.2

Product Type: Chemical

CAS NO: 616204-22-9Metabolic Disease inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000204899
Form: buffered aqueous solution
Immunogen sequence: RILNTGLDMETLSICVRLCEQGINPE
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q08AG7
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human MZT1
Linkage: Corresponding Antibody HPA066715.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/1/138

Product Name: PrEST Antigen ATP6V1D

Synonym: ATP6M; VATD; VMA8

Product Type: Chemical

CAS NO: Infection inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000100554
Form: buffered aqueous solution
Immunogen sequence: VNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKIT
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9Y5K8
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human ATP6V1D
Linkage: Corresponding Antibody HPA057316.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/1/127

Product Name: PrEST Antigen GXYLT2

Synonym: GLT8D4

Product Type: Chemical

CAS NO: 19542-67-7Endocrinology inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000172986
Form: buffered aqueous solution
Immunogen sequence: MNLTRIRSTQFKNSMIPTGLAWEDMLYPLYQKYKNAITWGDQ
Mol wt: predicted mol wt 23 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: A0PJZ3
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human GXYLT2
Linkage: Corresponding Antibody HPA068429.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/1/119

Product Name: PrEST Antigen PEX11G

Product Type: Chemical

CAS NO: 3317-67-7Cardiovascular Disease inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000104883
Form: buffered aqueous solution
Immunogen sequence: SALESYRGRDRLIRVLGYCCQLVGGVLVEQCPARSEVGTRLLVVSTQLSHCRT
Mol wt: predicted mol wt 23 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q96HA9
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human PEX11G
Linkage: Corresponding Antibody HPA069817.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/1/111

Product Name: PrEST Antigen METAP1D

Synonym: MAP1D; Metap1l

Product Type: Chemical

CAS NO: 128-62-1Others inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000172878
Form: buffered aqueous solution
Immunogen sequence: VGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHA
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q6UB28
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human METAP1D
Linkage: Corresponding Antibody HPA030298.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/1/101

Product Name: PrEST Antigen KIAA0368

Synonym: ECM29; FLJ22036

Product Type: Chemical

CAS NO: 55-86-7Estrogen Receptor_ERR inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000136813
Form: buffered aqueous solution
Immunogen sequence: GVGLGTKGGCASVIVSLTTQCPQDLTPYSGKLMSALLSGLTDRNSVIQKSCAFAMGHLVRTSRDSSTEKLLQKLNGWYMEKEEPIYKTSCALTIHAIGRYSPDVLKNHAKEVL
Mol wt: predicted mol wt 30 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human KIAA0368
Linkage: Corresponding Antibody HPA059795.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/302/1/1

Product Name: PrEST Antigen CRACR2A

Synonym: EFCAB4B; MGC4266

Product Type: Chemical

CAS NO: 1629125-65-0Androgen Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000130038
Form: buffered aqueous solution
Immunogen sequence: KEEPHLLSNFEDFLTRIISQLQEAHEEKNELECALKRKIAAYDEEIQHLYEEMEQQIKSEKEQFLLKDTERFQARSQELEQKLLCK
Mol wt: predicted mol wt 28 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9BSW2
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human CRACR2A
Linkage: Corresponding Antibody HPA038685.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/3/993