PrEST Antigen UGT1A6

Product Name: PrEST Antigen UGT1A6

Synonym: GNT1; HLUGP; UGT1F

Product Type: Chemical

CAS NO: 165682-93-9Syk inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000167165
Form: buffered aqueous solution
Immunogen sequence: WLSMKDIVEVLSDRGHEIVVVVPEVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIGLY
Mol wt: predicted mol wt 28 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P19224
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human UGT1A6
Linkage: Corresponding Antibody HPA054065.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/3/915

PrEST Antigen DPF3

Product Name: PrEST Antigen DPF3

Synonym: BAF45c; Cerd4; FLJ14079; cer-d4

Product Type: Chemical

CAS NO: 110505-75-4ROS inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000205683
Form: buffered aqueous solution
Immunogen sequence: KLRLLEIKPEVELPLKKDGFTSESTTLEALLRGEGVEKKVDAREEESIQEIQRVLENDENVEEGNEEEDLEEDIPKRKNRTRGRA
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q92784
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human DPF3
Linkage: Corresponding Antibody HPA066790.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/3/908

PrEST Antigen COQ2

Product Name: PrEST Antigen COQ2

Synonym: CL640; FLJ26072

Product Type: Chemical

CAS NO: 1332708-14-1PKA inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000173085
Form: buffered aqueous solution
Immunogen sequence: INDMWDQDYDKKVTRTANRPIAAGDI
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human COQ2
Linkage: Corresponding Antibody HPA068727.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/3/900

PrEST Antigen RNF212

Product Name: PrEST Antigen RNF212

Synonym: FLJ38841; LOC285498

Product Type: Chemical

CAS NO: 142273-20-9Itk inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000178222
Form: buffered aqueous solution
Immunogen sequence: KLLEFIKHVCYHRHQSHRPCAPGWFCQVLQRPGAVSGEKTQQTRPAPPATCLLCLSCLSGFRHGPWRSQALPSDLVAPLFVSYTVEVSITNAGWS
Mol wt: predicted mol wt 28 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q495C1
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human RNF212
Linkage: Corresponding Antibody HPA057527.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/3/893

PrEST Antigen FTCD

Product Name: PrEST Antigen FTCD

Product Type: Chemical

CAS NO: 1338545-07-5Insulin Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000160282
Form: buffered aqueous solution
Immunogen sequence: MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEH
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: O95954
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human FTCD
Linkage: Corresponding Antibody HPA030929.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/3/884

PrEST Antigen RAB43

Product Name: PrEST Antigen RAB43

Synonym: ISY1; RAB11B; RAB41

Product Type: Chemical

CAS NO: 152918-18-8FGFR inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000172780
Form: buffered aqueous solution
Immunogen sequence: EAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGW
Mol wt: predicted mol wt 22 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q86YS6
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human RAB43
Linkage: Corresponding Antibody HPA060085.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/3/878

PrEST Antigen DAK

Product Name: PrEST Antigen DAK

Synonym: DKFZP586B1621; NET45

Product Type: Chemical

CAS NO: 518303-20-3Ephrin Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000149476
Form: buffered aqueous solution
Immunogen sequence: PGDRTMLDSLWAAGQELQAWKSPGADLLQVLTKAVKSAEAAAEATKNMEAGAGRASYISSARLEQPDPGAVAAAAILRAIL
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q3LXA3
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human DAK
Linkage: Corresponding Antibody HPA048186.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/3/867

PrEST Antigen HMGA2

Product Name: PrEST Antigen HMGA2

Synonym: BABL; HMGIC; LIPO

Product Type: Chemical

CAS NO: 36396-99-3Discoidin Domain Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000149948
Form: buffered aqueous solution
Immunogen sequence: MSARGEGAGQPSTSAQGQPAAPAPQKRGR
Mol wt: predicted mol wt 20 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P52926
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human HMGA2
Linkage: Corresponding Antibody HPA039076.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/3/852

PrEST Antigen KRT1

Product Name: PrEST Antigen KRT1

Synonym: EHK1; KRT1A

Product Type: Chemical

CAS NO: 176199-48-7c-Kit inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000167768
Form: buffered aqueous solution
Immunogen sequence: FINNLRRRVDQLKSDQSRLDSELK
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P04264
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human KRT1
Linkage: Corresponding Antibody HPA062908.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/3/838

PrEST Antigen SOWAHC

Product Name: PrEST Antigen SOWAHC

Synonym: ANKRD57; C2orf26; FLJ21870

Product Type: Chemical

CAS NO: 198978-94-8BMX Kinase inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000198142
Form: buffered aqueous solution
Immunogen sequence: EAVLRFLAERGGRALHAELVQHFRGALGGEPEQRARARAHFKELVNAVATVRVDPADGAKYVHLKKRFCEGPSEPSGDPPRIQVTA
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q53LP3
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human SOWAHC
Linkage: Corresponding Antibody HPA056131.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/3/830