C14-demethylase

Product Name: PrEST Antigen GTF3C5

Synonym: TFIIIC63; TFIIICepsilon; TFiiiC2-63

Product Type: Chemical

CAS NO: 1309684-94-3Phosphodiesterase (PDE) inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000148308
Form: buffered aqueous solution
Immunogen sequence: HREGYNNPPISGENLIGLSRARRPHNAIFVNFEDEEVPKQPLEAAAQTWRRVCTNPVDRKVEEELRKLFDIRPIWSRNA
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9Y5Q8
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human GTF3C5
Linkage: Corresponding Antibody HPA067063.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/3/1033

Product Name: PrEST Antigen KIAA0040

Product Type: Chemical

CAS NO: 1303607-60-4PDHK inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000235750
Form: buffered aqueous solution
Immunogen sequence: KKKKKDEEDLWISAQPKLLQMEKRPSLPV
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human KIAA0040
Linkage: Corresponding Antibody HPA068812.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/3/1025

Product Name: PrEST Antigen WDR48

Synonym: KIAA1449; P80; SPG60

Product Type: Chemical

CAS NO: 1049741-55-0Neprilysin inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000114742
Form: buffered aqueous solution
Immunogen sequence: SDMLQVRKVMEHVYEKIINLDNESQTTSSSNNEKPGEQEKEEDIAVLAEEKIELLCQDQVLDPNMDLRTVKHFIWKSGGDLTLHYR
Mol wt: predicted mol wt 28 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q8TAF3
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human WDR48
Linkage: Corresponding Antibody HPA058015.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/3/1020

Product Name: PrEST Antigen CORO1B

Synonym: coronin-2

Product Type: Chemical

CAS NO: 186611-52-9Nampt inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000172725
Form: buffered aqueous solution
Immunogen sequence: AYVPSKQRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAAGATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGD
Mol wt: predicted mol wt 28 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9BR76
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human CORO1B
Linkage: Corresponding Antibody HPA070456.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/3/1012

Product Name: PrEST Antigen ZBTB8A

Synonym: BOZF1; FLJ90065; ZBTB8; ZNF916A

Product Type: Chemical

CAS NO: 698394-73-9Mineralocorticoid Receptor inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000160062
Form: buffered aqueous solution
Immunogen sequence: SQPSEVTHYKSSKREVRTSDSSSHVSQSEEQAQIDAEMDSTPVGYQYGQGSDVTSKSFPDDLPRMRFKCPYC
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human ZBTB8A
Linkage: Corresponding Antibody HPA031769.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/3/1003

Product Name: PrEST Antigen CLIC4

Synonym: CLIC4L; DKFZP566G223; H1; P64H1; huH1

Product Type: Chemical

CAS NO: 1700693-08-8MAGL inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000169504
Form: buffered aqueous solution
Immunogen sequence: MALSMPLNGLKEEDKEPLIELFVK
Mol wt: predicted mol wt 20 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9Y696
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human CLIC4
Linkage: Corresponding Antibody HPA060804.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/3.cover-expansion

Product Name: PrEST Antigen EHHADH

Synonym: ECHD

Product Type: Chemical

CAS NO: 110044-82-1LXR inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000113790
Form: buffered aqueous solution
Immunogen sequence: ILGEGIAASPEHIDVVYLHGYGWPRHKGGPMFYASTVGLPTVLEKLQKYYRQNPDIPQLEPSDYLKKLASQGNPPLKE
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q08426
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human EHHADH
Linkage: Corresponding Antibody HPA042021.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/2/774

Product Name: PrEST Antigen TM4SF20

Synonym: FLJ22800; TCCE518

Product Type: Chemical

CAS NO: 1393466-87-9Isocitrate Dehydrogenase (IDH) inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000168955
Form: buffered aqueous solution
Immunogen sequence: QALLKGPLMCNSPSNSNANCEFSLKNISDI
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q53R12
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human TM4SF20
Linkage: Corresponding Antibody HPA063184.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/2/765

Product Name: PrEST Antigen NUDT6

Synonym: FGF-AS; FGF2AS; gfg; gfg-1

Product Type: Chemical

CAS NO: 22862-76-6Indoleamine 23-Dioxygenase (IDO) inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000170917
Form: buffered aqueous solution
Immunogen sequence: HIPILQSRFIAPAASLGFRFHHAESDSSTLTLWLREGPSRLPGYASHQVGVAGAVFDESTRKILVVQDRNKLKNMWKFPGGLSEPEEDIGD
Mol wt: predicted mol wt 28 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P53370
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human NUDT6
Linkage: Corresponding Antibody HPA066115.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/2/753

Product Name: PrEST Antigen CDIPT

Synonym: PIS; PIS1

Product Type: Chemical

CAS NO: 252025-52-8HIV Protease inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000103502
Form: buffered aqueous solution
Immunogen sequence: LTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDR
Mol wt: predicted mol wt 22 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: O14735
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human CDIPT
Linkage: Corresponding Antibody HPA056597.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/2/747