C14-demethylase

Product Name: PrEST Antigen CYP3A43

Product Type: Chemical

CAS NO: 1402821-24-2CRAC Channel inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000021461
Form: buffered aqueous solution
Immunogen sequence: FLGTILFYLRGLWNFDRECNEKYGE
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9HB55
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human CYP3A43
Linkage: Corresponding Antibody HPA066463.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/2/501

Product Name: PrEST Antigen SSH2

Synonym: KIAA1725

Product Type: Chemical

CAS NO: 159857-79-1CFTR inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000141298
Form: buffered aqueous solution
Immunogen sequence: RVEIIEYTHIVTSPNHTGPGSEIATSEKSGEQGLRKVNMEKSVTVLCTLDENLNRTLDPNQVSLHPQVLPLPHSSSPEHNRPTDHPTSILSSPE
Mol wt: predicted mol wt 28 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q76I76
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human SSH2
Linkage: Corresponding Antibody HPA057099.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/2/494

Product Name: PrEST Antigen TBC1D17

Synonym: FLJ12168

Product Type: Chemical

CAS NO: 863971-53-3Calcium Channel inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000104946
Form: buffered aqueous solution
Immunogen sequence: GVYLHTSAKKYQDRDSLIAGVIRVVEKDNDVLLHWAPVEEAGDSTQILFSKKDSSGGDSCASEEEPTFDPGYEPDWAVISTVRPQLCHSEPTRGAEPSC
Mol wt: predicted mol wt 28 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9HA65
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human TBC1D17
Linkage: Corresponding Antibody HPA068119.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/2/488

Product Name: PrEST Antigen C17orf107

Product Type: Chemical

CAS NO: 146-48-5BCRP inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000205710
Form: buffered aqueous solution
Immunogen sequence: SARLLVQGAWLCLCGRGLQGSASFLRQSQQQLGLGIPGEPVSSGH
Mol wt: predicted mol wt 22 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q6ZR85
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human C17orf107
Linkage: Corresponding Antibody HPA069713.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/2/478

Product Name: PrEST Antigen XPR1

Synonym: SYG1; X3

Product Type: Chemical

CAS NO: 1297538-32-9ATP Synthase inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000143324
Form: buffered aqueous solution
Immunogen sequence: RFVWNFFRLENEHLNNCGEFRAVRDISVAPLNADDQTLLEQMMDQDDGVRNRQKNRSWKYNQSISLRRPRLASQSKARDTKVLIEDTDDEANT
Mol wt: predicted mol wt 29 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9UBH6
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human XPR1
Linkage: Corresponding Antibody HPA016557.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/2/467

Product Name: PrEST Antigen ITPR2

Synonym: CFAP48; IP3R2

Product Type: Chemical

CAS NO: Ribosomal S6 Kinase (RSK) inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000123104
Form: buffered aqueous solution
Immunogen sequence: KDDFTMEVDRLKNRTPVTGSHQVPTMTLTTMMEACAKENCSPTIPASNTADEEYEDGIERTC
Mol wt: predicted mol wt 25 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q14571
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human ITPR2
Linkage: Corresponding Antibody HPA059144.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/2/459

Product Name: PrEST Antigen RCC2

Synonym: TD-60

Product Type: Chemical

CAS NO: 1022958-60-6Raf inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000179051
Form: buffered aqueous solution
Immunogen sequence: ESTISWGPSPTFGELGYGDHKPKSSTAAQEVKTLDGIFSEQVAMGYSHSLVIARDESETEKEKIKKLPEYN
Mol wt: predicted mol wt 25 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9P258
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human RCC2
Linkage: Corresponding Antibody HPA072281.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/2/451

Product Name: PrEST Antigen WBP2

Synonym: WBP-2

Product Type: Chemical

CAS NO: 3211-76-5MNK inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000132471
Form: buffered aqueous solution
Immunogen sequence: VNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFG
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q969T9
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human WBP2
Linkage: Corresponding Antibody HPA065682.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/2/441

Product Name: PrEST Antigen CHD5

Product Type: Chemical

CAS NO: 886-50-0MEK inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000116254
Form: buffered aqueous solution
Immunogen sequence: GYMDEKDPGAQKPRQPLEVQALPAALDRVESEDKHESPASKERAREERPEETEKAPPSPEQLPREEVLPEKEKILDKLELSLIHSR
Mol wt: predicted mol wt 27 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q8TDI0
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human CHD5
Linkage: Corresponding Antibody HPA055477.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/2/435

Product Name: PrEST Antigen ANP32A

Synonym: APRIL; PHAPI2; SSP29

Product Type: Chemical

CAS NO: 893422-47-4MAPKAPK2 (MK2) inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000140350
Form: buffered aqueous solution
Immunogen sequence: GLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLK
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P39687
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant protein fragment of Human ANP32A
Linkage: Corresponding Antibody HPA067561.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/301/2/427