C14-demethylase

Product Name: PrEST Antigen RAD23A

Synonym: HHR23A; MGC111083

Product Type: Chemical

CAS NO: 1381289-58-2Arenavirus inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000179262
Form: buffered aqueous solution
Immunogen sequence: YLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQ
Mol wt: predicted mol wt 22 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P54725
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human RAD23A
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA065599.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/300/3.cover-expansion

Product Name: PrEST Antigen TEX22

Product Type: Chemical

CAS NO: 1825355-56-3Anti-infection inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000226174
Form: buffered aqueous solution
Immunogen sequence: QLHCRDVVQMVAQLVSEDVDKDVLLPHPLRSTESTNAFQAFLARSAPFWHNATFEAS
Mol wt: predicted mol wt 24 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: C9J3V5
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human TEX22
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA065576.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/300/2/716

Product Name: PrEST Antigen NPHP4

Synonym: KIAA0673; POC10; SLSN4

Product Type: Chemical

CAS NO: 143901-35-3Acids and Aldehydes inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000131697
Form: buffered aqueous solution
Immunogen sequence: SQALVLRSRLRLPEMVGHPAFAVIFQLEYVFSSPAGVDGNAASVTSLSNLACMHMVRWAVWNPLLEADSGRVTLPLQGGIQPNPSHCLVYKVPSASMSSEEVKQVESGTLRFQ
Mol wt: predicted mol wt 30 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: O75161
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human NPHP4
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA065526.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/300/2/709

Product Name: PrEST Antigen ZNF80

Synonym: pT17

Product Type: Chemical

CAS NO: 1386874-06-1Alkaloid inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000174255
Form: buffered aqueous solution
Immunogen sequence: LEHRKDFGYHSAFAQQSKIHSGGKNL
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P51504
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human ZNF80
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA065484.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/300/2/702

Product Name: PrEST Antigen CXCL5

Synonym: ENA-78; SCYB5

Product Type: Chemical

CAS NO: 202592-23-2Steroids inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000163735
Form: buffered aqueous solution
Immunogen sequence: RCVCLQTTQGVHPKMISNLQVFAIGP
Mol wt: predicted mol wt 20 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: P42830
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human CXCL5
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA065474.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/300/2/695

Product Name: PrEST Antigen C5orf60

Product Type: Chemical

CAS NO: 1269055-85-7Quinones inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000204661
Form: buffered aqueous solution
Immunogen sequence: REPSSVPPREEDSENDQAEVGEWLRIGNKYITLKDYRILLKELENLEIYTFLSK
Mol wt: predicted mol wt 24 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: A6NFR6
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human C5orf60
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA065431.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/300/2/688

Product Name: PrEST Antigen NFE2L1

Synonym: FLJ00380; LCR-F1; NRF1; TCF11

Product Type: Chemical

CAS NO: 1239358-85-0Saccharides and Glycosides inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000082641
Form: buffered aqueous solution
Immunogen sequence: LNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLLIP
Mol wt: predicted mol wt 26 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q14494
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human NFE2L1
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA065424.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/300/2/681

Product Name: PrEST Antigen MEX3D

Synonym: KIAA2031; OK/SW-cl.4; RKHD1; RNF193; Tino

Product Type: Chemical

CAS NO: 479-98-1Cell_Counting_Kit-8 inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000181588
Form: buffered aqueous solution
Immunogen sequence: DVFAGFAPHPAALGPPTLLADQMSVICGRKK
Mol wt: predicted mol wt 21 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q86XN8
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human MEX3D
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA065385.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/300/2/673

Product Name: PrEST Antigen SMIM12

Synonym: C1orf212; FLJ90372

Product Type: Chemical

CAS NO: 1798871-31-4Phosphatase_Inhibitor_Cocktail_I inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000163866
Form: buffered aqueous solution
Immunogen sequence: LEWFIRGKDPQPVEEEKSISERREDRKLDELLGKDHTQVVSLKDKLEFAPKAVLNRNRPEKN
Mol wt: predicted mol wt 25 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q96EX1
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human SMIM12
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA065331.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/300/2/668

Product Name: PrEST Antigen GGACT

Synonym: A2LD1

Product Type: Chemical

CAS NO: Protease_Inhibitor_Cocktail_mini-Tablet inhibitors
Assay: >80% (SDS-PAGE)
Concentration: ≥0.5 mg/mL
Conjugate: His tagged
Ensembl | human accession no.: ENSG00000134864
Form: buffered aqueous solution
Immunogen sequence: TLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDDFESCP
Mol wt: predicted mol wt 23 kDa
Purified by: immobilized metal affinity chromatography (IMAC)
Recombinant: expressed in E. coli
Shipped in: wet ice
Storage condition: avoid repeated freeze/thaw cycles
Storage temp.: −20°C
UniProt accession no.: Q9BVM4
Application: Suitable as a blocking agent using corresponding antibodies.
General description: Recombinant fragment of Human GGACT
Legal InFormation: Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Linkage: Corresponding Antibody HPA065320.
Physical Form: Solution in 1 M urea-PBS, pH 7.4
Preparation Note: The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
RIDADR: NONH for all modes of transport
WGK Germany: 2
Purity: >80% (SDS-PAGE)
Storage Temp.: −20°C
PubMed ID:http://jpet.aspetjournals.org/content/300/2/662